SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081479 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081479
Domain Number 1 Region: 618-666
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000144
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  FBpp0081479
Domain Number - Region: 399-440
Classification Level Classification E-value
Superfamily YefM-like 0.0602
Family YefM-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081479   Gene: FBgn0002932   Transcript: FBtr0082001
Sequence length 672
Comment pep:known chromosome:BDGP5:3R:4846068:4865189:-1 gene:FBgn0002932 transcript:FBtr0082001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQSAGKIVRRSPSSCPGPNNLPPLQFHSVHGDNIRISRDGTLARRFESFCRAITFSARP
VRINERICVKFAEISNNWNGGIRFGFTSNDPVTLEGTLPKYACPDLTNRPGFWAKALHEQ
YCEKDNILYYYVNGAGDVIYGINNEEKGVILTGIDTRSLLWTVIDIYGNCTGIEFLDSRI
YMYQQQPAAIPMATVPAQQQQMPQPAANASSALNSHHPHQQSRRSLPGHTAAIEHDLERH
VMPSLQSLHLAGNGGSVASVEQAAIAHDLANGLPPLRYNANGRLIPVPFHNTKGRNVRLS
QDRFVASRTESDFCQGYVFTARPIRIGEKLIVQVLKTEQMYVGALALGLTSCNPAMLQPN
DLPNDSDFLLDRPEYWVVSKDIAAAPQRGDEIAFFVAPNGEVSISKNNGPAVVVMHVDQS
LQLWAFLDVYGSTQSLRMFRQQLPNMVAYPSQPQVNVNASSSSACNAASTSRMLPMTESM
SSLNAGATAKLLHHPSQLSVAQSTSTLASAGGVNGSRMISMPSNGDILQIQPNGGGTVLV
VNLPPASSSHDINGQLAARPTATVTSSGVLAGACSSGTLISTTSSQYIEQPIANSTNNAA
NKWKDSLSDQQSTDSSAECTICYENPIDSVLYMCGHMCMCYDCAIEQWRGVGGGQCPLCR
AVIRDVIRTYTT
Download sequence
Identical sequences E1JIG1
FBpp0081479 FBpp0289643 FBpp0081479 FBpp0289643 NP_001163563.1.81976 NP_731310.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]