SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081481 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081481
Domain Number 1 Region: 700-748
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000169
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  FBpp0081481
Domain Number - Region: 481-522
Classification Level Classification E-value
Superfamily YefM-like 0.0706
Family YefM-like 0.013
Further Details:      
 
Domain Number - Region: 11-60
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0732
Family beta-sandwich domain of Sec23/24 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081481   Gene: FBgn0002932   Transcript: FBtr0082003
Sequence length 754
Comment pep:known chromosome:BDGP5:3R:4846068:4859449:-1 gene:FBgn0002932 transcript:FBtr0082003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDIPANYMQGSHPHLTLHPQQQHHQNQQHLQHLQQMQQLHNAMPTPAQQAAQVLAME
SNELLMSTKDKLSSKKKMHLLKKIKKRFGLVRRSPSSCPGPNNLPPLQFHSVHGDNIRIS
RDGTLARRFESFCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTSNDPVTLEGTL
PKYACPDLTNRPGFWAKALHEQYCEKDNILYYYVNGAGDVIYGINNEEKGVILTGIDTRS
LLWTVIDIYGNCTGIEFLDSRIYMYQQQPAAIPMATVPAQQQQMPQPAANASSALNSHHP
HQQSRRSLPGHTAAIEHDLERHVMPSLQSLHLAGNGGSVASVEQAAIAHDLANGLPPLRY
NANGRLIPVPFHNTKGRNVRLSQDRFVASRTESDFCQGYVFTARPIRIGEKLIVQVLKTE
QMYVGALALGLTSCNPAMLQPNDLPNDSDFLLDRPEYWVVSKDIAAAPQRGDEIAFFVAP
NGEVSISKNNGPAVVVMHVDQSLQLWAFLDVYGSTQSLRMFRQQLPNMVAYPSQPQVNVN
ASSSSACNAASTSRMLPMTESMSSLNAGATAKLLHHPSQLSVAQSTSTLASAGGVNGSRM
ISMPSNGDILQIQPNGGGTVLVVNLPPASSSHDINGQLAARPTATVTSSGVLAGACSSGT
LISTTSSQYIEQPIANSTNNAANKWKDSLSDQQSTDSSAECTICYENPIDSVLYMCGHMC
MCYDCAIEQWRGVGGGQCPLCRAVIRDVIRTYTT
Download sequence
Identical sequences P29503
FBpp0081481 FBpp0081481 FBpp0081479 NP_476652.1.81976 7227.FBpp0081481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]