SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081482 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081482
Domain Number 1 Region: 699-747
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000158
Family RING finger domain, C3HC4 0.01
Further Details:      
 
Weak hits

Sequence:  FBpp0081482
Domain Number - Region: 481-522
Classification Level Classification E-value
Superfamily YefM-like 0.0706
Family YefM-like 0.013
Further Details:      
 
Domain Number - Region: 11-60
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0732
Family beta-sandwich domain of Sec23/24 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081482   Gene: FBgn0002932   Transcript: FBtr0082004
Sequence length 753
Comment pep:known chromosome:BDGP5:3R:4846068:4859449:-1 gene:FBgn0002932 transcript:FBtr0082004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSDIPANYMQGSHPHLTLHPQQQHHQNQQHLQHLQQMQQLHNAMPTPAQQAAQVLAME
SNELLMSTKDKLSSKKKMHLLKKIKKRFGLVRRSPSSCPGPNNLPPLQFHSVHGDNIRIS
RDGTLARRFESFCRAITFSARPVRINERICVKFAEISNNWNGGIRFGFTSNDPVTLEGTL
PKYACPDLTNRPGFWAKALHEQYCEKDNILYYYVNGAGDVIYGINNEEKGVILTGIDTRS
LLWTVIDIYGNCTGIEFLDSRIYMYQQQPAAIPMATVPAQQQQMPQPAANASSALNSHHP
HQQSRRSLPGHTAAIEHDLERHVMPSLQSLHLAGNGGSVASVEQAAIAHDLANGLPPLRY
NANGRLIPVPFHNTKGRNVRLSQDRFVASRTESDFCQGYVFTARPIRIGEKLIVQVLKTE
QMYVGALALGLTSCNPAMLQPNDLPNDSDFLLDRPEYWVVSKDIAAAPQRGDEIAFFVAP
NGEVSISKNNGPAVVVMHVDQSLQLWAFLDVYGSTQSLRMFRQQLPNMVAYPSQPQVNVN
ASSSSACNAASTSRMLPMTESMSSLNAGATAKLLHHPSQLSVAQSTSTLASAGGVNGSRM
ISMPSNGDILQIQPNGGGTVLVVNLPPASSSHDINGQLAARPTATVTSSGVLAGACSSGT
LISTTSSQYIEPIANSTNNAANKWKDSLSDQQSTDSSAECTICYENPIDSVLYMCGHMCM
CYDCAIEQWRGVGGGQCPLCRAVIRDVIRTYTT
Download sequence
Identical sequences NP_731311.1.81976 FBpp0081482 FBpp0081482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]