SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081530 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081530
Domain Number 1 Region: 1053-1314
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-78
Family Protein kinases, catalytic subunit 0.00000145
Further Details:      
 
Domain Number 2 Region: 13-286
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.37e-38
Family FCH domain 0.01
Further Details:      
 
Domain Number 3 Region: 951-1080
Classification Level Classification E-value
Superfamily SH2 domain 1.62e-22
Family SH2 domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081530   Gene: FBgn0000723   Transcript: FBtr0082052
Sequence length 1325
Comment pep:known chromosome:BDGP5:3R:5193325:5220268:-1 gene:FBgn0000723 transcript:FBtr0082052 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFSSALQSRAAHEALIVRQDAELRLMETMKRSIQMKAKCDKEYAISLTAVAQQGLKIDR
ADEMQGSLISKSWRSYMDELDHQAKQFKFNAEQLEVVCDKLTHLSQDKRKARKAYQEEHA
KIAARLNHLTDEVVRKKSEYQKHLEGYKALRTRFEENYIKAPSRSGRKLDDVRDKYQKAC
RKLHLTHNEYVLSITEAIEVEKDFRNVLLPGLLEHQQSVQESFILLWRNILQEAAQYGDL
TADKYKEIQKRIDTVIGSINPTEEYGEFTEKYKTSPTTPLLFQFDETLIQDIPGKLQSST
LTVDNLTVDWLRNRLQELEGAVRDCQEKQMKMIEHVNGGSPVANGSIISNGSNTSNGIQS
NKDSLCRQSKDLNALRCQEKQKQKLVDMIKCALNEVGCEELPSGCDDDLTLEQNFIENGY
NNEQQRSNSTSSPGLGIMNELMRRGGVLTLLRGRGRHFKRKSTPQPATPMTRSRQGRFNK
LQPRSQSLGSLSVIRDGNGPSPARYEPITNHRLRQAASVHYLGEEIATSSTNPPDLTRLR
RTQCSMLCLGEDEEPVVLASPAPLTQLTAAVLTNTNNNHIYADLELDKKKDTSPSPECKG
EQIQPKKEQIRIEINQTAPQNSIDAHLDRIDELNRVLDDRLKRTLQPSDDVNAIESAEEN
HIQTRKLAKDPDSQTKRSSSSSSECRSSKDTSHSKKRSLSFSQKSISNIFSNLKEFSKSP
LVRMGKNHILNEEQDAKRTQPSQHHHSSGSDCPTNSSSSSSNNNNNNKNTSSNSNHSASQ
STIITSTITTTITTTTTTTPSKENSRLKFKVPKIQKKSKAIRNTFRSKLLNFQLKRSKPC
KQCTKRRRIHPSKSVFDFAKEFEVEQPAGSAADEQFCNCPPAGQKPVKPSVQISGHKDHP
FESSSGELDENSDRDIDNDEEEEDSASDDVLSMKDHCYCVPSLAASISLSTNRPLYEEEW
FHGVLPREEVVRLLNNDGDFLVRETIRNEESQIVLSVCWNGHKHFIVQTTGEGNFRFEGP
PFASIQELIMHQYHSELPVTVKSGAILRRPVCRERWELSNDDVVLLERIGRGNFGDVYKA
KLKSTKLDVAVKTCRMTLPDEQKRKFLQEGRILKQYDHPNIVKLIGICVQKQPIMIVMEL
VLGGSLLTYLRKNSNGLTTRQQMGMCRDAAAGMRYLESKNCIHRDLAARNCLVDLEHSVK
ISDFGMSREEEEYIVSDGMKQIPVKWTAPEALNFGKYTSLCDVWSYGILMWEIFSKGDTP
YSGMTNSRARERIDTGYRMPTPKSTPEEMYRLMLQCWAADAESRPHFDEIYNVVDALILR
LDNSH
Download sequence
Identical sequences P18106
FBpp0081530 FBpp0081530 FBpp0081529 7227.FBpp0081530 NP_524288.3.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]