SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081541 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081541
Domain Number 1 Region: 453-655,696-841
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.51e-44
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.031
Further Details:      
 
Weak hits

Sequence:  FBpp0081541
Domain Number - Region: 240-269
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00282
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.051
Further Details:      
 
Domain Number - Region: 357-425
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 0.0422
Family 4-alpha-glucanotransferase, N-terminal domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081541   Gene: FBgn0037703   Transcript: FBtr0082063
Sequence length 854
Comment pep:known chromosome:BDGP5:3R:5341731:5346660:1 gene:FBgn0037703 transcript:FBtr0082063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQKELAALVATRTSRKRTISSTSFSISTRTDPKSIIEIHIFNDSLPIKRACCEVENPTL
KAEQRVQQEEESLGQVPPLTEEEQQRHDEFRNSGSIFLQDLPCFKLQQAQPIAGSSPIPK
CRECRRRNLATTEGEPSSVSDVYCRFYEFRRLQFNENGELCVVGFPNPYSEPSPEDIAIW
QPDKNTPPTSGYMDIQVCRYILLHAGDQFCYIWHQEAEALSLHQNTDGTIAWKKAVKGTR
EICDVCDTTLFNYHWTCRKCGFGVCLDCVKDRKEGLRLRRAENAAQKGCDEYHWLLCSDP
SGPQEHVLTELMLTQIIAGDALNVLGRLLHEVRTLWQVPQVCGCLLSKQAIEDAQSKEVI
QDMIKESQLKQHTSYSSLASEQKVHQQQRLDQLHATKLEFARELGVDYVPGRVWTKETLG
KDPITTAFDNLKHINFLRKGLAGLRRFLPPRTMTFAYSTQLAPGVPHEFLCDGRLLRLTD
AMHPDNRVLFQEVWKCGQPVMISEVARSLNLDLWHPQAFCRDFGDKPNDLINCLNGNLVP
NQPMRHFWEGFQCMTKRLPDAYGKPMLLKLKDWPPGDDFAEILPTRFADLMKGLPMPEYT
LRTGNLNIASCLPKMFVPPDLGPKMYNAYGSALHPDKGTTNLHLDISDAVNIMVYVGIPQ
DGDTRPQMAATQKAIEIGGCDYITRARCQSPDVLPGALWHIFPARDADKIRDLLNRVTLE
KGFRLEPDHDPIHDQNWYLDDKLRARLFKEYGVEGHPIVQCLGDAVFIPAGAPHQVQNLH
NCIKVAEDFVSPENITHCYHLTHEFRRLSHSHTNHEDKLQIKNIIYHAIKDCCTILTRAV
DERLNAELTKLNAD
Download sequence
Identical sequences Q9VHC5
NP_001287255.1.81976 NP_788611.1.81976 FBpp0081541 7227.FBpp0081541 FBpp0081541 FBpp0081541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]