SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081580 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081580
Domain Number 1 Region: 192-307
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 5.64e-36
Family MBT repeat 0.0000278
Further Details:      
 
Domain Number 2 Region: 282-383
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 6.77e-33
Family MBT repeat 0.0000208
Further Details:      
 
Domain Number 3 Region: 796-868
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.95e-16
Family SAM (sterile alpha motif) domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081580   Gene: FBgn0003334   Transcript: FBtr0082102
Sequence length 877
Comment pep:known chromosome:BDGP5:3R:5459081:5463329:-1 gene:FBgn0003334 transcript:FBtr0082102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGRDSSTSSGSNSAAPGASTNATSSASASASSTSTSASPGSTTSPASTQRQRGRPAKR
ATCTWCGEGKLPLQYVLPTQTGKKEFCSETCIAEFRKAYSKGACTQCDNVIRDGAPNKEF
CSIMCMNKHQKKNCSTRHSGGSASGKGLAESERKLLASGAPAPTGPFQYESFHVFDWDAY
LEETGSEAAPAKCFKQAQNPPNNDFKIGMKLEALDPRNVTSTCIATVVGVLGSRLRLRLD
GSDSQNDFWRLVDSTEIHAIGHCEKNGGMLQPPLGFRMNASSWPGYLCKILNNAMVAPEE
IFQPEPPEPEENLFKVGQKLEAVDKKNPQLICCATVDAIKDDQIHVTFDGWRGAFDYWCN
YRSRDIFPAGWCARSCHPMQPPGHKSRMDSSSSKQRCPRPRYTVVAESEAMVPASPATAH
FHPNCKGGPFINNSKLPCMVTGPTYQTLAKLCLQEVLAASTDTQQLSKLLFALEGDVHIV
TAAGKNFTVKIPSPMRMKDDESLAQFIETLCTTCRACANLISLVHETEECKKCANSRKRQ
LTQSATPPSSPVLADKRNRQSNSATTSPSEKIIKQELAVKSPVESKSKTSTNNGKEPASQ
QNSNHSLNNNNNSASKSSNKVVIKSEPNGANAQTSSTTQALRKVRFQHHANTNTNSSATN
GNQDTSQTTHVSTSHCSSSSTSSSTSLAGGSANTSTIGKYLAPLVAEVHPEQANVKPSNS
YYKSPTTLSSSASLPTSVSTPFTGCQSASSTALAAGGVTAAKAATAPAGAAATAGASPSY
TAITSPVSTPTSALANSHLRSQPIDWTIEEVIQYIESNDNSLAVHGDLFRKHEIDGKALL
LLNSEMMMKYMGLKLGPALKICNLVNKVNGRRNNLAL
Download sequence
Identical sequences A0A0B4K6M7 Q9VHA0
FBpp0081580 FBpp0081580 NP_001247006.1.81976 NP_731385.1.81976 FBpp0081580 FBpp0297150 7227.FBpp0081580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]