SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081594 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081594
Domain Number 1 Region: 750-818
Classification Level Classification E-value
Superfamily RING/U-box 2.07e-20
Family RING finger domain, C3HC4 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081594   Gene: FBgn0037705   Transcript: FBtr0082116
Sequence length 868
Comment pep:known chromosome:BDGP5:3R:5363876:5377528:-1 gene:FBgn0037705 transcript:FBtr0082116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNSNATGGNNHGGSSRRPFTRNSSSVRSQRGGGGGLGGRMVYSPHTHPHVQQQQQQQQQ
QQQQGQQRSSNNGNNNLWLGNSPWCNVNLNGGNSGNNNNNGGNNNNNNGGNISSNNNSNN
VNNKDANPNCHSQGQGPGNSPNLGHNHQRGYNNGNNNRGIGNGIVNGNTNGPPDYMNYRR
GVCPAQSRDYSGNGNGNNNGHGHNGRRYMSDNLNNPSSSMNGLINSGHHQRNYNDRNLNN
HFGNSEQNGGPDHRDRAEGSSYNFMRNGGGSGGGGYGRNGSHYQHMAYGNNNGASTSTGG
PGLMGELPSGSGLSGSSLSLNNGPGGLNSDSPSRKRRRISGRPPNGPQPQHRCPMAHMQQ
GSPPLRRPRLRDVATSTQQQQQQYGHQVHHPQQQQQQPPSNYHPMHHHQPQPHYVPQQQV
PPPHVQRSPWDLGSSGGSSGGATSSSSVGPILQQVQAPPQPPSHQQAVGYPQAPPQPASL
MVDLNLNQVPVNLQLRPSEPFWASFCTYPIPAQARLAPCHLHGVYTQPFPAAPPPGLAAP
PLQQQHQPLIQAQQMISQATLTAQQQQRDVVAIATANLGPIEAPGAHGHPHAHPHAHPHA
HQLPPGIHITPLSGAAAAAATHHLHSTAAAAAAVAAGAQITTAQQILFSSDRRTFPPHRR
IPRFWTANHGHRHVLPPQSLAAHQAPVQIQATSGIINPGFLLNFLAMFPLSPYNQHDLSS
GDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVCMCDFE
LRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNASDYFDGVDQQQQSQATAGAAAALS
GTSGGSAGVAGTSEASAATANPQQSQAA
Download sequence
Identical sequences Q8SX72
FBpp0081594 FBpp0081595 FBpp0081594 FBpp0081595 NP_649902.2.81976 NP_731366.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]