SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081596 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081596
Domain Number 1 Region: 1055-1123
Classification Level Classification E-value
Superfamily RING/U-box 3.06e-20
Family RING finger domain, C3HC4 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081596   Gene: FBgn0037705   Transcript: FBtr0082118
Sequence length 1173
Comment pep:known chromosome:BDGP5:3R:5363876:5377060:-1 gene:FBgn0037705 transcript:FBtr0082118 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLNSNATGGNNHGGSSRRPFTRNSSSVRSQRGGGGGLGGRMVYSPHTHPHVQQQQQQQQQ
QQQQGQQRSSNNGNNNLWLGNSPWCNVNLNGGNSGNNNNNGGNNNNNNGGNISSNNNSNN
VNNKDANPNCDVQTSNSSGTCIYNNSKAHHHHNNSNNNGHTQSHIHTNHSLHQGHHHPHH
TQMHTPHYPHSSSPQQSNSYRQYPPHSYSPNSPHSNGHTNSNASNNPISQRSNPQAHPNQ
NQNSNFYEMCTGSGGSHTYGSMSVSLVRLNPARLCLTLGPVTPPAQRVVSFGHRSHSHSN
SSSNTSSSDQNQHNPPPRSQNHHPNPHHSQYQYQYQYQYRYQYHPPHQYHPLHSPQQQTN
RQSLPLTRTNSNSINATTFNSTNPTTNSNPTDVVNVNSCTDIIPYGSSSTSSSASSMLPQ
QQQHQINNASAPINSHSQGQGPGNSPNLGHNHQRGYNNGNNNRGIGNGIVNGNTNGPPDY
MNYRRGVCPAQSRDYSGNGNGNNNGHGHNGRRYMSDNLNNPSSSMNGLINSGHHQRNYND
RNLNNHFGNSEQNGGPDHRDRAEGSSYNFMRNGGGSGGGGYGRNGSHYQHMAYGNNNGAS
TSTGGPGLMGELPSGSGLSGSSLSLNNGPGGLNSDSPSRKRRRISGRPPNGPQPQHRCPM
AHMQQGSPPLRRPRLRDVATSTQQQQQQYGHQVHHPQQQQQQPPSNYHPMHHHQPQPHYV
PQQQVPPPHVQRSPWDLGSSGGSSGGATSSSSVGPILQQVQAPPQPPSHQQAVGYPQAPP
QPASLMVDLNLNQVPVNLQLRPSEPFWASFCTYPIPAQARLAPCHLHGVYTQPFPAAPPP
GLAAPPLQQQHQPLIQAQQMISQATLTAQQQQRDVVAIATANLGPIEAPGAHGHPHAHPH
AHPHAHQLPPGIHITPLSGAAAAAATHHLHSTAAAAAAVAAGAQITTAQQILFSSDRRTF
PPHRRIPRFWTANHGHRHVLPPQSLAAHQAPVQIQATSGIINPGFLLNFLAMFPLSPYNQ
HDLSSGDTNETENYEALLSLAERLGEAKPRGLTRNEIDQLPSYKFNPEVHNGDQSSCVVC
MCDFELRQLLRVLPCSHEFHAKCVDKWLRSNRTCPICRGNASDYFDGVDQQQQSQATAGA
AAALSGTSGGSAGVAGTSEASAATANPQQSQAA
Download sequence
Identical sequences Q9VHC2
FBpp0081596 7227.FBpp0081596 NP_731367.2.81976 FBpp0081595 FBpp0081596

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]