SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081674 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081674
Domain Number 1 Region: 221-284
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000911
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 
Domain Number 2 Region: 285-360
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Weak hits

Sequence:  FBpp0081674
Domain Number - Region: 9-73
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0373
Family Cold shock DNA-binding domain-like 0.012
Further Details:      
 
Domain Number - Region: 59-116
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0824
Family Chromo barrel domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081674   Gene: FBgn0028734   Transcript: FBtr0082196
Sequence length 529
Comment pep:known chromosome:BDGP5:3R:5929822:5935843:-1 gene:FBgn0028734 transcript:FBtr0082196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLLVEVRLDNGAYYKGQVTAVADDGIFVDVDGVPESMKYPFVNVRLPPEETVEVAAPI
FEEGMEVEVFTRTNDRETCGWWVGIIKMRKAEIYAVAYIGFETSYTEICELGRLRAKNSN
PPITAKTFYQFTLPVPEELREEAQKDGIHKEFQRTIDAGVCNYSRDLDALIVISKFEHTQ
KRASMLKDMHFRNLSQKVMLLKRTEEAARQLETTKLMSRGNYVEEFRVRDDLMGLAIGSH
GSNIQAARTVDGVTNIELEEKSCTFKISGETEESVQRARAMLEYAEEFFQVPRELVGKVI
GKNGRIIQEIVDKSGVFRIKDQNIPRELAHVPFVFIGTVESIANAKVLLEYHLSHLKEVE
QLRQEKMEIDQQLRAIQESSMGSTQSFPVTRRSERGYSSDIESVRSMRGGGGGQRGRVRG
RGGGGPGGGNGLNQRYHNNRRDEDDYNSRGDHQRDQQRGYNDRGGGDNTGSYRGGGGGAG
GPGNNRRGGINRRPPRNDQQNGRDYQHHNHTTEEVRETREMSSVERDTN
Download sequence
Identical sequences FBpp0081674 NP_731446.1.81976 FBpp0081674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]