SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0081909 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0081909
Domain Number 1 Region: 1169-1236
Classification Level Classification E-value
Superfamily RING/U-box 6.41e-20
Family RING finger domain, C3HC4 0.0036
Further Details:      
 
Weak hits

Sequence:  FBpp0081909
Domain Number - Region: 731-740
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0811
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0081909   Gene: FBgn0037944   Transcript: FBtr0082433
Sequence length 1256
Comment pep:known chromosome:BDGP5:3R:7570205:7574747:-1 gene:FBgn0037944 transcript:FBtr0082433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSLENDQEELHHQPRVTLAYGSVATSSGGQENHSQYAMYYNQQRDSEGYMLMTPFLSSS
QSHSHTRSPPTYTAMVEPRREESSGFEGLARRCDKCSSLDGLCRCESMVASSSRYADSTQ
NQSHSEAQFLEQPSSSTAAIANPPAVHSIPRPKRKKTEPLTMEPESDNDGDAVVASVSGT
WPAGAIEEHAMDSTAVVYEVPSSSLQLSNSSFETAPSAVNAYDDVTSSASDTEHGQFAHT
RTTNTTTTTSAVQAHKKKASRSNNASNTSSRAVDTDATPSTSAQSRKRQMSQFSYRKSRV
LEPENESSDDGWDLRVHNPVPPIEPTVTIIRGSRGSDEAEIGHTDHNYYNSRCAVAGAPP
DSTYIRSASCSTATHTTRSVDYGSRIGRRSAATGSPSTSSDQEQEQQQRQQQEEIIHEER
RHQQSPGQPMHSMYGVPGESRMSWSRARPSDDSVPPRKHARMELPGRSRSKLSSTNFNSF
YPGRRGHRTFAEQGNSSGQHHVRFPPSSTPNSNGPCVITYVGRPRDSQPAADLNLPSTST
GRRGSHETRADSVVLTAPDLQLDDWSSDDDDDDVVFVHSTREPILSIDLTSDDDGLANDT
QLQRDRDRGRERERERARDREPYRNDTQPNPEDPNEDRRTMYDCAYTFPYARRTDRRTEA
NNEGTSAFAFYSGALADRAAISDHNYSYELDQLMDPGPGNFYPPRCSNMDPQRYFLPINE
SSMWMPGHPAPPPPPPPMPPILLPDNSSTEAYLRHQQRNLTSTPSSSSSEQTSTQQSRHR
RSSPANVYHRYHPYYYAITTLPTVVESDYPPSLQPHPHPHPHFQPSQGGSSRSSLSGALN
AAAVAATAAAVQAQTFSDLLSQAHNEGRAAALEGNRTPPHTMVHAQHQQRQSINPPAPGV
ASNANLAAAVSPPPPLEMYSGRSTIPHCGSPPFSVRRSEAAYSNRQHYQPQPHQGHQAPQ
NQMHAHIHPPHRASAIVATSLTPAPPYPVHQNLWYRQQSMQEMHRRHMTPTPIDLSSNAP
LLTSTLRNGYLHSICSCVHARNGPVSSLDPAYYPPYDAAPAAAAPPPSPQQQSPATSGSG
NSSVAAQASMRHLQLQPQQQPQAQQSPPVMQHMQRQRAIHHHMFHHHYSPLHLEIGLAPL
SLGSRILIAPSRPNRGATLETIERNTLPHKYRRVRRPSETDEDAEKCAICLNLFEIENEV
RRLPCMHLFHTDCVDQWLVTNKHCPICRVDIETHMPNDALPPSSSGVPDAANSAAL
Download sequence
Identical sequences Q9VGI6
FBpp0081908 FBpp0081909 FBpp0300326 FBpp0081908 FBpp0081909 FBpp0081908 NP_001247056.1.81976 NP_650112.1.81976 NP_731623.1.81976 7227.FBpp0081909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]