SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082058 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082058
Domain Number 1 Region: 1272-1381
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.06e-22
Family Elongation factor TFIIS domain 2 0.0061
Further Details:      
 
Domain Number 2 Region: 898-965
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 9.08e-18
Family PHD domain 0.00031
Further Details:      
 
Domain Number 3 Region: 1137-1196
Classification Level Classification E-value
Superfamily BRK domain-like 0.00000000000000837
Family BRK domain-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082058   Gene: FBgn0082831   Transcript: FBtr0082586
Sequence length 2016
Comment pep:known chromosome:BDGP5:3R:8239550:8246973:1 gene:FBgn0082831 transcript:FBtr0082586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSVFTEAPSARPAAAEADSNLVVVYSKSGISFDERAIGNIMEEKSISTISVVRITSPT
PSMVDQEEDERLEELANFMETATDSELDSDNGSQSGGDNASEMDEHDEENHNTGDDNNSD
STETEADAPRTRKRVGRKPKAIKKRKRRKPKERPQIVGLRVEQFYADNTADMVVKNALKL
AGVSVYKRTAETDALMEVIRNDHNYTPFTSPEQLKNHKRDEKMAMEMQAQSRKIIMQAPG
SVKLINAKKRVQAIPLSPVQVKVQRLPVKPHQVQQAAQLQPKVQLIRKPIHSPLPRQKPE
IIANNSVNARLRPTRAPVKVIAPPVQEYIEDDDDAQSSDSAEEENADKAYDSEEMSEESD
EFQESDNDRDSDMDFDMRHSNRRNPNKRKRVRKVVRQTPSKPMKPLPPPPTTPQHFPELK
KRKEVLEPKAPQIGQIIQMPATKSVPAVFALGRGLPSTSFLKIRPTHQSLPVKRPPLPTT
PANSNVRRMPAVQLGRIVNSPQEVKEIIINKNMASPKGVFTNLNTLLGEDNNAATKSSPV
PLRHRAVMSPSTPRSSYNQQMSPIVVPVPAQAHTPSKGFMPIGVDTAQSHKLPAQIVIET
HQSSSELAAENDKQLDLINSIVQDELLKSTLVEQPVVNADEDIPKLVKMLESTAADLDPP
PVSLPTNIFPAPEMQGVGNAAAADPNNIMDTANEDEITADFLQHVVGLIEEDKQFEAEVV
KQVLASTEPGTLDAIVSMPTSIEPVDVPQAHTNLLPNASLTEPAQSMTSLPIACSTPSRS
VAASTPPTSAKVVRGYGRVIYLPPIEAPTTRAKRRAQFPSAPGMAATSSSDAGNLSFGES
SLDASINQPLNTSSLSNDSQPGSGPKRPNPREPSMARRSTAPRRSKKLDASQNNDPDASE
SQEDDDDPNKLWCICRQPHNNRFMICCDLCEDWFHGTCVGVTKAMGTDMENKGIDWKCPK
CVKRQEERSQPRITDMLVTRPTTQPEQRPSETKVLTTTAEIVQVAAPSAPRRTLPVVLTV
ASSPMRIPMAKPAKKFPTGAISHQQQQQLNFIRLGPSPGKRISETLCVVCKRPASTSSVY
CGEECIRKYAQSAIQAHAATKGPLPQNAGAQSLLNNSFDAKKNKKKDLFEDVLRQADTVS
KVERINVFERKSGRVITGHMAPSAHQFRKWLQENPSFEVLPSGTVQSADAEKRLLKGAPE
AATSTSEPAVLGVAKKPPEGPAKLSHPQNTTVQASHQLGISSVRPLAKKDKEKTTPTVQA
PTPNRIAAGKPEPVRIGIRRSLREQLLARIKEAQAAEENSGQPTTQWPTVLEVDQFVKNV
ELEMFNSFGRDVGAKYKAKYRSLMFNIKDRKNRTLFEKICAKQVEPRQLVRMTPEQLASQ
ELAKWREEENRHQLDMIKKSELDLLACAQNYVVKTHKGEEVIATKVDVTLPEENVSEASS
MADTKQTSLVSEPSTSTLERSTSREKAGSSKEKRHKSHKHHHRKRSRSRSNSRGRSVDKR
HRRQHNEGGEQPGSGEREHRSREKQSRERDEIVPSPLPKKRDENDQSPVPKKTAEKKTEA
SAYNLVDQILESEKTVEQAANLGKPKPSPKPLPTLPSSLKAPEPMDNYSRYLHGLTTSSL
WSGTLKMIDLADFEIVMYPVQGNCHQLGNLMPSQMDVIGRITRVNVWEYIKKLKKSPTKE
VVIVNIFPASPSETYKFDLFFEYLDSRQRLGVLGVDSDQIRDFYIFPLGSGDKLPPALQT
AEPVPFYEEAQRPNTLLGIIVRCLSKRPADAVPSTPSVPTPVPALSSKVAKRSRSSISYP
AQSSPKRKISTHSTSSKDDEFDIDAIIKAPIAKLQKTAPKVVPQPSVPNDADEPYSPGGS
DDELVPSAPQRPNDLERQVNEINKQIAAQQMEIAGLLKVEPTGSASSSNVLAAISIPANL
SKILASIKDKTNLPSSADDGDEEYNPEDDITATSSFASKKPRSKGRLAHLSEAELLSMVP
DNLAGVIPRSSRTRHQLAQSPLTPTPLPPPPPPPGV
Download sequence
Identical sequences Q9VG78
FBpp0082058 7227.FBpp0082058 NP_650193.1.81976 FBpp0082058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]