SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082202 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082202
Domain Number 1 Region: 75-137
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000048
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082202   Gene: FBgn0038125   Transcript: FBtr0082734
Sequence length 239
Comment pep:known chromosome:BDGP5:3R:9017423:9018231:1 gene:FBgn0038125 transcript:FBtr0082734 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVARENDPPNHCYINEEVPANETAENPSHGLQGEVISKGYIPDLSNANVNQQQQQEND
GEDDLLPGTRLRYRRRNLHLDPYVCNECNQYVRGGVITICGHLFCWTCLWPKLSGTAQPR
CPCCQRHLLMYEDIMPFHGEGPNARQEDNNVPAQPGSVPRPTGLYLSDTDFPCWFAVNDP
VDGCPATFPDIRRERDLHCAIRLIPMVYPWIGAQISFLKWFQLGCVLLIFLIWSVLSLF
Download sequence
Identical sequences Q9VFY3
FBpp0082202 FBpp0082202 NP_731776.1.81976 FBpp0082202 7227.FBpp0082202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]