SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082311 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082311
Domain Number 1 Region: 144-434
Classification Level Classification E-value
Superfamily L domain-like 7.03e-59
Family Ngr ectodomain-like 0.086
Further Details:      
 
Domain Number 2 Region: 478-670
Classification Level Classification E-value
Superfamily L domain-like 7.37e-33
Family Leucine rich effector protein YopM 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082311   Gene: FBgn0028487   Transcript: FBtr0082846
Sequence length 693
Comment pep:known chromosome:BDGP5:3R:9520979:9526560:-1 gene:FBgn0028487 transcript:FBtr0082846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMNLSNVELGSFRGAQECDQASAFGGDFDFGHSCFTHYGCPSDMSDKTGRGRSNPSTSRI
PRSAQSPRQASVVHSPRTNCAFRPIFHERSTHEDDQVLTQELWKLARKSGTLNLSNKALA
RVPKRLYDINEADADSKAVNLEQLTIKEEDAWWNQVPLNNLDLSSNTLTHISPKIENLQS
LTVLTLHDNALVELPPEIGKLEKLVRLNVSHNKLSQLPRAMYSLPELRHLNISYNEFVEL
NPDISDLHMLEFLDGGHNNIQSLPGGIGFLVRLTALLLPYNHIKELPPDLVNMRSLQKID
LMHNDLTSLPEDMGLLRKLDCLYLQHNDILELPEFEGNEALNELHASNNFIKIIPKAMCS
NLPHLKILDLRDNKITELPDELCLLRNLNRLDVSNNTISVLPVTLSSLAHLISLQVEGNP
IKTIRRDILQCGTTRILKTLHDRAVAKAKEEGGGVDDASTSAGISVTRLRGGQMDDGDIP
GNFPDRYKLRHTRTLAVNLEELTSVPDQVFQIARDEGVHVVDFARNQLSTLPNGLQHMKD
LVTELVLSNNVIGYVPQFISQFTRISFLNLSNNLLNDLPTEFGVLNTLRELNIANNRFPC
IPNCVYELQGLEILIASENHIKMLNVSGLQNMRRLSTLDLRNNDIETVPPILGNLTNITH
LELVGNPFRQPRHQILMKGTDAIMSYLRDRIPT
Download sequence
Identical sequences Q9V3X1
NP_731852.2.81976 FBpp0111852 FBpp0082311 FBpp0082311 7227.FBpp0082311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]