SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082312 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082312
Domain Number 1 Region: 101-391
Classification Level Classification E-value
Superfamily L domain-like 2.28e-58
Family Ngr ectodomain-like 0.086
Further Details:      
 
Domain Number 2 Region: 435-627
Classification Level Classification E-value
Superfamily L domain-like 7.48e-33
Family Leucine rich effector protein YopM 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082312   Gene: FBgn0028487   Transcript: FBtr0082847
Sequence length 650
Comment pep:known chromosome:BDGP5:3R:9520979:9525263:-1 gene:FBgn0028487 transcript:FBtr0082847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDKTGRGRSNPSTSRIPRSAQSPRQASVVHSPRTNCAFRPIFHERSTHEDDQVLTQELW
KLARKSGTLNLSNKALARVPKRLYDINEADADSKAVNLEQLTIKEEDAWWNQVPLNNLDL
SSNTLTHISPKIENLQSLTVLTLHDNALVELPPEIGKLEKLVRLNVSHNKLSQLPRAMYS
LPELRHLNISYNEFVELNPDISDLHMLEFLDGGHNNIQSLPGGIGFLVRLTALLLPYNHI
KELPPDLVNMRSLQKIDLMHNDLTSLPEDMGLLRKLDCLYLQHNDILELPEFEGNEALNE
LHASNNFIKIIPKAMCSNLPHLKILDLRDNKITELPDELCLLRNLNRLDVSNNTISVLPV
TLSSLAHLISLQVEGNPIKTIRRDILQCGTTRILKTLHDRAVAKAKEEGGGVDDASTSAG
ISVTRLRGGQMDDGDIPGNFPDRYKLRHTRTLAVNLEELTSVPDQVFQIARDEGVHVVDF
ARNQLSTLPNGLQHMKDLVTELVLSNNVIGYVPQFISQFTRISFLNLSNNLLNDLPTEFG
VLNTLRELNIANNRFPCIPNCVYELQGLEILIASENHIKMLNVSGLQNMRRLSTLDLRNN
DIETVPPILGNLTNITHLELVGNPFRQPRHQILMKGTDAIMSYLRDRIPT
Download sequence
Identical sequences Q7KSK8
NP_650306.1.81976 FBpp0082312 FBpp0082312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]