SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082340 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082340
Domain Number 1 Region: 10-100
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.62e-16
Family PWWP domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082340   Gene: FBgn0038190   Transcript: FBtr0082877
Sequence length 231
Comment pep:known chromosome:BDGP5:3R:9775946:9776860:-1 gene:FBgn0038190 transcript:FBtr0082877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRRRAKMPNFTIGDFVFAKLRRYRPWPGRILNRIGATAYSVYFYGSCNYAKVARKEVVD
YEKNLHRLGVVQQKGHVCNPSFRASMLQAREAFDNPDKDYGYYQQLAVNNGDCINAEDLG
LEYLVTEDLGNLLDEQAATEQVVAEKDVNEQVAVEQNVELNSLGQIFSNQEHEKDSEDSA
SNCQLEEKDQSNSEVVKEQVSERHYSMAQIVSLKSKKLMDTPINMTCQRRR
Download sequence
Identical sequences Q9VFP7
FBpp0082340 NP_001303460.1.81976 NP_650323.2.81976 FBpp0082340 FBpp0082340 7227.FBpp0082340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]