SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082345 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082345
Domain Number 1 Region: 121-309
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.85e-19
Family Extended AAA-ATPase domain 0.0000225
Further Details:      
 
Weak hits

Sequence:  FBpp0082345
Domain Number - Region: 2-95
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000337
Family Extended AAA-ATPase domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082345   Gene: FBgn0051495   Transcript: FBtr0082882
Sequence length 341
Comment pep:known chromosome:BDGP5:3R:9663960:9665652:-1 gene:FBgn0051495 transcript:FBtr0082882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVNITLPNTEERVNLLKSRINRLGDITVAGDVCAREIAMKTKNFTEDELCQLVREALHEA
IVRTHVTRCPKGLQVTQVDLLAAVKIIQPRFGRQEETLQLLMPYEYLDRTAFDPNDLLST
GRPRWSCHLVEGKPKSGLTTVAAQMALKTDCPFIKYISSAELLGLSDSEKCQRIREVLED
AYVSRRSCVIIDDFERVIGYGALGKRYSKEFLQKLTVLLKKQPPNSHELIIICTSNRLDV
LEELGLLSVFTSVHNVPNVSTPKELMVIVEASKRFEPEELRQIEIAMDGRNVSIGIKRLL
DLIAWVNSLNPDRRAAKLLKKLGEAMGWVGNHSSPLVPQYI
Download sequence
Identical sequences Q8ING5
NP_001287320.1.81976 NP_731866.1.81976 FBpp0082345 FBpp0082345 7227.FBpp0082345 FBpp0082345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]