SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082463 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082463
Domain Number 1 Region: 326-487
Classification Level Classification E-value
Superfamily L domain-like 3.12e-39
Family L domain 0.00015
Further Details:      
 
Domain Number 2 Region: 40-214
Classification Level Classification E-value
Superfamily L domain-like 2.84e-36
Family L domain 0.00016
Further Details:      
 
Domain Number 3 Region: 490-639,803-847
Classification Level Classification E-value
Superfamily Fibronectin type III 1.37e-23
Family Fibronectin type III 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082463   Gene: FBgn0038279   Transcript: FBtr0083004
Sequence length 868
Comment pep:known chromosome:BDGP5:3R:10744402:10748027:1 gene:FBgn0038279 transcript:FBtr0083004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHLHPVPNPLPIPISIAVPLILLFLGASSPVLASSDDQTACGSLEINKIADLRKLQNCT
HVVGHVRLAYVDLTDVSGNYSLDSLASNVTEISDYLMVYRCTGLISLQSIFPRLRIIRGQ
ELLFDQYSLVVYENRNLRELGLVELLRIQSGFIRVESNPLLCFVETVDWIYLMGNATRQH
FSLKHNRPQSQCPLCGSLSADFEFIRNSSERCWNVNTTQLRPQPPRLKDCPIACGLNGCD
SAGKCCDHNCVTGCYSQNCSLCANYQGRMGCVNQCVASYELNKRRCIGHRECRELGRIPL
IRGYQCVKKCPGNQKEILVAKGIIHCQVECNGDFHVKSAADLEVLQDCVTINGSLTIELT
NIKEKIVDALENALASVKEITGYLKVIHSAQLMSLTFLQNLDAIRGDKLVENKYALYVVN
NYHLEHIWPPNHLVIIQRGTLFFHLNPRLCYEKIHQLQGSLKSGENISVADVSPNSNGER
VICGDAVRSLNPKVEDLNSTAVRIILDYMDWEGMETLIGYSYHYKEAPVQNVTMYDGRHG
CGHDNWLMDVVPNQSRRHVISGLKPYTQYAYFVKTLTRTEYHIQIDAYSKIGYFQTLPDR
PSPVLRIYGSSEISSQILLHWWPPRRPNGVIKNYFVTAEKYNATKEAKDKNYVNVELENA
KDIDCECAGVLPYYSGPQPDDEDYYNKEQITYEDALPNLIYVSRNHDYRRKEFEKVINYE
HLLSIKKDEEPTRPPTTTPAPTNATLAKERLAAINYENYRLNSEKKQRDLQDLDQHKYTI
RHALPKCQNSHASVVQQVEEKCVAEEPLSGYELPGTQHFYCLSQLEPETHYRITIRACVE
GVVNGCSTPAEAVIKTASIQLERFIKGV
Download sequence
Identical sequences Q9VFE2
FBpp0082463 FBpp0082463 7227.FBpp0082463 NP_001287331.1.81976 NP_650408.1.81976 FBpp0082463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]