SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082568 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0082568
Domain Number - Region: 89-243
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00141
Family Arfaptin, Rac-binding fragment 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082568   Gene: FBgn0026634   Transcript: FBtr0083114
Sequence length 710
Comment pep:known chromosome:BDGP5:3R:11184190:11187396:-1 gene:FBgn0026634 transcript:FBtr0083114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHDPVKKSAHLTAGSTSTAEKLCFDKNEFMKANFSVDEFLHKNRNAPSLEQLRDNLGLYL
KGLRAAMIDLINEDYADFVNLSANLVGLDQNIKTIQQPLEQFRSDIESIHGLIDENVTEL
RAQLEEKRQLREFKRGLQSLKKVYETINKLQDLIDRKLSGEQPIKAVDLERAALDLIQLK
FHEKHCFKHLSPDHQGKIQQLEEQLHQHLRRFFNDALSQARNSAPESLERCLRIYITLNA
CDQAECAFREDVVAPYMTGVIGEQQLQNSPQGLAGIYSKILNFISLHMTDLLRLTLYSDK
FPGFNFVVNSYWSDVETRLELHMNSIFAPGNSEVFYVKYKCTRDFLGKIEELLTCSGEQA
VTFYRQHKQTKSFEARWNLPVYFQICFQEIAGKFEAQLEPVLQEDSLKDNLTDSDYKISA
FNAAKEAMTRCWAEGVYLPEVFPKFYKLNVQVVLRLSRWITDAITQSKGSNFSKPYTRNQ
LLIALHADIRKLDAHLPELQQLIIKSVPVEQCTKIFSDVLAKSMSCLADTLGAHLTNIQK
TLVELLIGECETENVRQVNDLPRLYRKTNREVPTRCSSYVEQMLRPLKAFAQQNESQLGT
LVVEQILAEVASHITKAYFNVVSDVLTSVQKTEESLRRLRNVKSGGAATVSTGSSAVMSD
DDKIRVQLRVDVTSWRQELCKLNFQATQIDKLVELTNMVEDSIKLKDNSA
Download sequence
Identical sequences Q9VF78
FBpp0082568 FBpp0082568 FBpp0082568 NP_524366.1.81976 7227.FBpp0082568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]