SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082765 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082765
Domain Number 1 Region: 87-222
Classification Level Classification E-value
Superfamily TPR-like 9.25e-28
Family Tetratricopeptide repeat (TPR) 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082765   Gene: FBgn0038428   Transcript: FBtr0083314
Sequence length 263
Comment pep:known chromosome:BDGP5:3R:12267728:12268729:-1 gene:FBgn0038428 transcript:FBtr0083314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNANSDDEFHDAIGEEITEKEATSTRQSEKDVDEIVEKQNQLALDDEAEQGAAGGDSI
ATPTTVDSELTIEELREREKDLSPEQLTANKEKADKLKVEGNELFKNDDAEGAAKTYTEA
LDICPSASSKERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAKLYEQE
DKPDEALEDYKKVTEIDPGQQEAREAQIRLPPIINERNEKLKNEMMSSLKDLGNMILKPF
GLSTQNFQMQQDPNTGSYSINFK
Download sequence
Identical sequences Q9VEV3
FBpp0082765 FBpp0082765 7227.FBpp0082765 FBpp0082765 NP_001262636.1.81976 NP_650543.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]