SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082798 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082798
Domain Number 1 Region: 336-621
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.13e-45
Family Eukaryotic proteases 0.001
Further Details:      
 
Domain Number 2 Region: 161-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 23-63
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000102
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 4 Region: 243-287
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000195
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 5 Region: 68-105
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 6 Region: 122-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000144
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082798   Gene: FBgn0051217   Transcript: FBtr0083353
Sequence length 628
Comment pep:known chromosome:BDGP5:3R:12478168:12481489:-1 gene:FBgn0051217 transcript:FBtr0083353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQLISFLSNPLFFCALLLKFRTIFAACDSSQFECDNGSCISQYDVCNGEKNCPDGSDETA
LTCVSQRQHCTKPYFQCTYGACVIGTAGCNGVNECADGSDETRLRCGNEDDIRQHDRRLQ
GNCKENEFKCPSGICLDKSNFLCDGKDDCADGTGFDESVELCGHMECPAYSFKCGTGGCI
SGSLSCNGENDCYDGSDEAPLLCNTTKKVTTPVVTETPLELLGCPLPLGDERPILTGDGS
RVLTGPITRGTVRFSCKQGYVLEGEESSYCAKNKWSTSTIPKCVKYCSTAGEFDGYSTKA
LCTHNGQQVECRKPFHPPGTEVKFVCSTGFKTLSPLPEMRCMKGGYWNRGRQRCEQDCGQ
LATPIKQFSSGGYTINNTVVPWHVGLYVWHNEKDYHFQCGGSLLTPDLVITAAHCVYDEG
TRLPYSYDTFRVIAAKFYRNYGETTPEEKRRDVRLIEIAPGYKGRTENYYQDLALLTLDE
PFELSHVIRPICVTFASFAEKESVTDDVQGKFAGWNIENKHELQFVPAVSKSNSVCRRNL
RDIQADKFCIFTQGKSLACQGDSGGGFTSELPTNAFSTWNTARHFLFGVISNAPNADQCA
HSLTVMTNIQHFEDMILNAMNRSVETRS
Download sequence
Identical sequences Q9VER6
FBpp0082798 FBpp0082798 NP_536776.2.81976 7227.FBpp0082798 FBpp0082798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]