SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082806 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082806
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily EF-hand 1.82e-32
Family Calmodulin-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082806   Gene: FBgn0020907   Transcript: FBtr0083361
Sequence length 184
Comment pep:known chromosome:BDGP5:3R:12400265:12409382:-1 gene:FBgn0020907 transcript:FBtr0083361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSISDFRKKKLLFLFNVFFDVNQSGEIDVKDFELAIERVCQLRGWQKDTPKNKETYDLMM
EIWTGLRSKADKDNDGQVSVDEWCNMWDAYAKDPSSVMDWQNAYMNFMFDLEDASHDGGI
DVTEFTLVCSSYGLEKTECEEAFAKMSQGQSEVTREQFAALWKEYFAAEDVNAPGNYIFG
KTSF
Download sequence
Identical sequences O16158
FBpp0082806 7227.FBpp0082806 NP_524381.1.81976 FBpp0082806 FBpp0082806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]