SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082811 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082811
Domain Number 1 Region: 28-171
Classification Level Classification E-value
Superfamily L domain-like 2.18e-17
Family U2A'-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082811   Gene: FBgn0051274   Transcript: FBtr0083368
Sequence length 227
Comment pep:known chromosome:BDGP5:3R:12818756:12820369:1 gene:FBgn0051274 transcript:FBtr0083368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITPNPYSFSGNISISSCPSEDVSFSESILEDNGRISLAYENLKTIPRRLADKFAAQTKF
LDLSHNDFRNLRFLSFFEDLDTLILDRNVNLDINTFPYLPSLRILWINNCDIANITDWIH
RIERHCPALDQLSCMGNPGIRTVFGGQGPREYILQVLPQLKYLDGLPTSRNAAYATLSSS
QGQGPDSTSNSEKPPLASAFTFKDIIRPKYSRKSHSGRMFGNGSSTN
Download sequence
Identical sequences Q8INA6
FBpp0082811 FBpp0082811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]