SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082877 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082877
Domain Number 1 Region: 36-319
Classification Level Classification E-value
Superfamily L domain-like 4.19e-52
Family Internalin LRR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082877   Gene: FBgn0028992   Transcript: FBtr0083436
Sequence length 326
Comment pep:known chromosome:BDGP5:3R:13217388:13218742:1 gene:FBgn0028992 transcript:FBtr0083436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDADRAMNEPEAAKTVSGIQVIPAEDVASIEDIITIDPDCYELDLNHRRIEKLENFEPL
TRIERLFLRWNLIKKIENLSSLKTLIELELYDNQITKIENLDDLPHLEVLDISFNRLTKI
ENLDKLVKLEKVYFVSNRITQIENLDMLTNLTMLELGDNKLKKIENIEMLVNLRQLFLGK
NKIAKIENLDTLVNLEILSLQANRIVKIENLEKLANLRELYVSENGVETIENLSENTKLE
TLDLAKNRLKGIANLEKLELLEELWLNHNGVDDWKDIELLKVNKALQTIYLEYNPLAKDV
RYRSKLRDILPQLQKIDATLCKVPGT
Download sequence
Identical sequences Q9VEK8
FBpp0082877 NP_650619.1.81976 7227.FBpp0082877 FBpp0082877 FBpp0082877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]