SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082897 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082897
Domain Number 1 Region: 391-516
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.62e-26
Family Eukaryotic type KH-domain (KH-domain type I) 0.00000325
Further Details:      
 
Domain Number 2 Region: 509-558
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000198
Family Retrovirus zinc finger-like domains 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082897   Gene: FBgn0025571   Transcript: FBtr0083456
Sequence length 787
Comment pep:known chromosome:BDGP5:3R:13366143:13370870:1 gene:FBgn0025571 transcript:FBtr0083456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSATPPDLLSLAASREVSAAVAVAASANGGSGRSADKERSRSRDRGRDKDKDRDKDRKKR
DKDSRDRDSRRRDDRGDRDRDRERDRDSRSHRSKSRNYDDGDRRRKRSRSRDRDRDRKRD
RDRDSRSRRSSSRGGRDDYDRSRRRRSRSRSYERRRNDRGSQRDQRDQHSQRSSRERTHV
NPFDTSNSRNSLNQDHDQSRIPSLFDRQQGLETIREEGREQRFDLTQTIQELMGNAGGNK
GFASFFNSQNSNDSTSNGAFDNSADSAAERKRKRKSRWGGSENDKTFIPGMPTILPSTLD
PAQQEAYLVQFQIEEISRKLRTGDLGITQNPEERSPSPEPIYSSDGKRLNTREFRYRKRL
EEQRHQLIVKMQTVNPEFKPPADYKPPVTRVSDKVLIPQEQHPDINFVGLLIGPRGNTLK
AMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGEDEPLHAFITAPNPEAVRKAVDKIKDV
IRQGIEVPEGHNDLRRMQLRELAQLNGTLRENDIQRCTCGSTDHKSWQCPDKPIITNTIV
CTSCGGTGHLTKDCRNKRPGSGVPGMACEDSQAKIDEEYMSLMAELGEGPPPPSASAKTD
PPASNGPQLHRASYSIFDKKPSQMQAIQSPPSSSSRDHQRDLGGWGAAAHEHGMGMEHGM
GLDQHGHGLAAMDHGMSLGMEHAMAAYVPAPPGTQAPPPMPPPLMPWMSAPQPPPPATEP
LNPPIPGTLPPLIPPPPGTSAPPMPPWGGGAYSGWGGGYAPPPPPPCAPPPPALSLSQPP
PPPPPSA
Download sequence
Identical sequences Q9VEJ1
FBpp0082897 NP_524654.2.81976 FBpp0082897 7227.FBpp0082897 FBpp0082897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]