SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0082933 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0082933
Domain Number 1 Region: 467-779
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.59e-50
Family Rhodopsin-like 0.0017
Further Details:      
 
Domain Number 2 Region: 112-365
Classification Level Classification E-value
Superfamily L domain-like 1.21e-20
Family Ngr ectodomain-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0082933   Gene: FBgn0016650   Transcript: FBtr0083509
Sequence length 831
Comment pep:known chromosome:BDGP5:3R:13551248:13558952:1 gene:FBgn0016650 transcript:FBtr0083509 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKHPSLSQRMGTTYRPRKGLKCLSFEFQCRLLLHHLLLTSLSGRHFVYATSAVGGALSA
NNCHDIHHGFDVYPNLTAVSLAQSTDTPLTATMPRSAWKCCCWNASNQAEEVECRCEGDG
LNRVPQTLTLPIQRLTIASAGLPRLRHTGLKVYGSTLLDVAFTDCLQLELIQDGAFANLT
LLRTIYITNAPKLTFLSKDVFLGISDTVDIIRIINSGLTRVPDLGHLPPHNILQMIDLDN
NQITRIDSKSIKVKTAQLILTNNEISYVDDSAFFGSKIAKLSLKENKKLQMMHPNAFDGI
IDITELDLSSTSLVGLPSAGLQNIEALYIQNTHTLKTIPSIYNFRNLQRAYLTHSFHCCA
FQFPSRHDPQRHAQRMLEIEKWRKQCKSDSGTRKERSTLDNPFNMPEDFGSFGGTDDSAT
DITPITFASFDYMADDTMNKGTFHEKIILNPGDDSSAELCGNFTFRKPNIECYPMPNDLN
PCEDVMGYQWLRISVWIVVALAVVGNVAVLTVILSIRPESTPVPRFLMCHLAFADLCLGL
YLLLVACIDAHSMGEYFNFAYDWQYGLGCKVAGFLTVFASHLSVFTLTVITIERWLAITQ
AMYLNHRIKLRPAALIMLGGWIYSMLMSSLPLFGISNYSSTSICLPMENRDVYDTIYLIA
ILGSNGVAFSIIAVCYAQIYLSLGRETRQAHQNSPGELSVAKKMALLVFTNFACWSPIAF
FGLTALAGYPLINVTKSKILLVFFYPLNSCADPYLYAILTSQYRQDLFTLLSKLGLCQQS
ALKYKDSLSGQATTRFTIHGSIQRHSSLTCKMQTVMGAETQKMLKNSEDYV
Download sequence
Identical sequences Q9VEG4
NP_524393.2.81976 NP_732265.1.81976 FBpp0082933 7227.FBpp0082933 FBpp0082933 FBpp0082934 FBpp0082933 FBpp0082934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]