SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083052 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083052
Domain Number 1 Region: 53-117
Classification Level Classification E-value
Superfamily RING/U-box 4.64e-22
Family RING finger domain, C3HC4 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083052   Gene: FBgn0038627   Transcript: FBtr0083632
Sequence length 147
Comment pep:known chromosome:BDGP5:3R:14398817:14416448:1 gene:FBgn0038627 transcript:FBtr0083632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDYFEELGHEPTGPLGANDLARNLKRLQVLAIMNGIDMEIEVPEASKRAILELPVHEIV
KSDEGGDLECSVCKEPAEEGQKYRILPCKHEFHEECILLWLKKTNSCPLCRYELETDDPV
YEELRRFRQDEANRRERENTLLDSMFG
Download sequence
Identical sequences A0A0B4LHA6 Q9VE61
FBpp0083052 FBpp0083052 FBpp0288650 7227.FBpp0288650 NP_001138076.1.81976 NP_001287394.1.81976 NP_650729.1.81976 FBpp0083052 FBpp0288650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]