SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083160 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083160
Domain Number 1 Region: 264-365
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-26
Family Zf-UBP 0.0061
Further Details:      
 
Domain Number 2 Region: 224-292
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000103
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 377-515
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000015
Family Tropomyosin 0.003
Further Details:      
 
Weak hits

Sequence:  FBpp0083160
Domain Number - Region: 142-214
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000241
Family Canonical RBD 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083160   Gene: FBgn0038686   Transcript: FBtr0083746
Sequence length 555
Comment pep:known chromosome:BDGP5:3R:15003807:15006044:-1 gene:FBgn0038686 transcript:FBtr0083746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLENISLCVIKIETDLDPSADSEGAVSAEHPTNPRVLKERERDRGLRQSRDITIETYTNQ
RWKRELSEPRQQEMNWVAAVQHVNSPSAGSSREITPRSGDDGQAGASASNFPQEIGYFSG
NPIVEVTKGLIHLYKKNERKAIKEAPSNQLCLLAVPATLNCHDLLNFIAPCHAEIKHIQI
VRDGSPNQFMVLLEFRSNESALEFYKSYNGSTYNSLEPDSLCHAVWVSEVERSEHGAPPM
GHTELPTCPVCLERMDESVDGVLTILCNHAFHASCLMKWGDSTCPVCRHVQTPGLVEDSV
CMECEGTDSLWICLICGHVGCGRYQGGHAAAHFRATNHTFAMQLGTSSVWDYAGDNFVHR
LFQNKSDGKLVASQTEKDEREEKIDSMQMEFTYLLTSQLDTQRKYYEERMERLEQEWQNH
KATANDAKTEVSELQQLQQNMQKEKVNLERKLAQHTAKLKDVQKQLNEERELSKALQSNQ
SSWHGKYKLLEQQYNEFKQTHDAEVTELKEQLRDIMFFLDNQQKLANTEIAGGTVTGIAE
KEPDPNTRRRNRRKK
Download sequence
Identical sequences Q9VDZ1
FBpp0083160 FBpp0083160 FBpp0083160 7227.FBpp0083160 NP_650789.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]