SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083178 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083178
Domain Number 1 Region: 7-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.95e-62
Family Calponin-homology domain, CH-domain 0.0000455
Further Details:      
 
Domain Number 2 Region: 2879-2999
Classification Level Classification E-value
Superfamily EF-hand 3.41e-39
Family EF-hand modules in multidomain proteins 0.0000597
Further Details:      
 
Domain Number 3 Region: 3000-3104
Classification Level Classification E-value
Superfamily EF-hand 3.36e-32
Family EF-hand modules in multidomain proteins 0.0000769
Further Details:      
 
Domain Number 4 Region: 3087-3173
Classification Level Classification E-value
Superfamily RING/U-box 4.36e-23
Family ZZ domain 0.0066
Further Details:      
 
Domain Number 5 Region: 2526-2654
Classification Level Classification E-value
Superfamily Spectrin repeat 1.23e-18
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 6 Region: 2356-2473
Classification Level Classification E-value
Superfamily Spectrin repeat 1.56e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 7 Region: 2682-2817
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000256
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 8 Region: 428-525
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000017
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 2846-2878
Classification Level Classification E-value
Superfamily WW domain 0.00000000623
Family WW domain 0.0014
Further Details:      
 
Domain Number 10 Region: 1245-1367
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000301
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 11 Region: 1352-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000302
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 12 Region: 312-417
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000602
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 13 Region: 1140-1240
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000288
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 14 Region: 491-617
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000633
Family Spectrin repeat 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0083178
Domain Number - Region: 2241-2365
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000705
Family Spectrin repeat 0.0097
Further Details:      
 
Domain Number - Region: 1009-1125
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00364
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number - Region: 1454-1582
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0226
Family Spectrin repeat 0.021
Further Details:      
 
Domain Number - Region: 2088-2158
Classification Level Classification E-value
Superfamily LemA-like 0.0929
Family LemA-like 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083178   Gene: FBgn0260003   Transcript: FBtr0083764
Sequence length 3497
Comment pep:known chromosome:BDGP5:3R:15289255:15420453:1 gene:FBgn0260003 transcript:FBtr0083764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGILIDERQHIQKKTFTKWINSHLIDTQCTPVKDLFLDLRDGHRLLALLSTLTQTNLK
PEKGRMRVHHINNLNKVITEIQQHGVKLVNISSDDIVGGNAKLTLGLIWLIALEFNGQHL
VKSHSSNGVEKSLLAWARQYTEPHGLQLNDFSSSWSDGRAFLMILDAHVEELNLQAALQQ
HALKRLHLAFDLAHRHFKIEKLLDAEDVHTHKPDNKSIQMYVMCLYHAMESMRTRQQEQE
QDEGQDQDPGRVPCTSITDLDEVPLDNDQTSLGLYTSDSAGSMEQRSSGELKTHSMRPLS
TATNASVEISGYQSALEAVLTLLLEDEQLLSQNLPDPQDFQTAKLQFHENESFMLKLTEH
QEYVGEALEEGSNLINESQKAGAGLSQEDQNEVRQQMVLLNERWETLRLRALDVQAKILM
RLAEFQKQKLEQLRQFLTSVEDRISHMSDIGPTLEEAEKQLLEAQKLKADLSEQQELVDS
LSSMVVIVNDTSGNFNDLEDRLSALGERWSHVVKWSDLRKEKLQQYKCISRWLDAREQDL
KLMESRDVTDVGGITQRINELNYCAKDLLELQRYLIDLRQMVAATLQDGDDKGERVLIQL
ESYEDRLDALKQIVEVQTVRIETKGFNFGRDRASYDDSRVVRPEGWVDYQMIIRFGEDDS
QEDDDEHDLASKKRKLRNADNFNALENHIMEHFGYVQEVEQKLQQLQRQSLRQQCELLKE
LQAENSRRCGTLPELKKLYEVCELEDPSRNLLLEETHIKQLEQRYANLSQKLSSQQSESH
TLLAKEKYYNSLTGFKLVLADSRDWYKQHAGSASGNELEQRLSHMESLASEISEAKTATE
ELDDNLIEWKQDFGLFYDSWHDMKQALQALIQQRGGESLSRQLKQIQDFVTKVSNQKVRV
SNLEVMQEQQHFLNQLLDEMESLRLTYDNIPKHLIGEELQTAWNRLPEQLNERVIKQTTA
IENLNHFAAEYNAIIAMLRSAADSKLNGSDGASSQDLRKLEIDVISARNFSEILIKEAEP
AQKESLQSQIRALNTLYDQVEQVHREKKEQQTVLQSHIDLIQLRLKETDQWLTDLESNTP
KSGISDIVNSNELFQSKSRFQTLKETCERETTQFRDLNERGGELLLQMDELQDQDRESRY
GSLAKQFTRINARWTEVTELVYAKTALLEHISTQLGEFKKFMVSETGYLDKLENKIRNTP
ENAADAEEIMEELDDLENVLRSHSEEWLDKIQEIGNELIDNEFMADSIRRDIDETVQRWT
QLQQQAKKRTELLEQKVSEAEQSEKCIVQFEKWLTRVDDILSDHLDNDVTIVDQPEEFQR
LAHEFVANEKNFKEISELIDEHTRNGKVGAANRLQEQLNLMEVRFKYCQAKLSKCTAIQH
SYESRLNRAYTDLRNVERSTEVVDVASAGPNTVQTQYQKCLQIYRTLSEIKSEIESTIKT
GRRVCEDRYTKSPKQLSQRIDALKHLYNTLGENVTQSKATLERLLTLARQLEECFDSADN
LIRRFESPQEVHDRNSILLEFEDVLRRCEDHYNEYNKSCDQSCMVETRQRIDGLKATYHK
LTSADIIKRLTEMKTTLQNLDNISLETLRAMEHDLKEINVPSNPEIEKLQQQVIAIVVDV
LKTRFNEATTLAARNTSSPDNDDTEIVVVSDTVRQRRARTPQSGESPSSAHTSSSESPTK
GVENSPGAVGDQVMPDLLPPQTFRLAESSTLFSQISLNPQKVTNTPPPKPAKTKRKAPSS
PAQVVEIRVKNIQNDKMSVQNIDLEPQQGEIVDTVNILESVEPFVPEYVETVQIVDLSED
SDSSVRVDSQGKEMRRSKSKHSLNETPLPKVSDNDEDSAEQEEDLLRPSAENTSTPFLRV
EKRRISFDEKRKRVANERDILRDSEEEEPKTPDTPRAAQVSKPKRWRQLQPEMDALEPES
PGRDSFYSPDKESGFDAEPLVFSDDEDIPRFSLEMTSTIDSDSDTSRIMTPSTKNPNPFL
SKVLESLSSPVDDSNVTLKSPISEEQPQNLDDRVREFDKQAKQMIYKLKLTKAKIEQCHE
SEAEDLRLLIAPDAATLISQGDSLVLETHGRQGSISRLVMRTQIILREQFREVQQARSKT
SGSGAPAPPLDSVNIEELVTKGLRRINVLIEKTVDLKSSTDLEKRMEDINERHDDLQVIV
SAIGKNAQMPKVTPLMMNEIEKTKNNLIAHADSIELSLTELRNGPRISNGKERPDASSAA
TMSCRSEYNNEPSGTGALAGSFDKSVLQISDWLTWEQNMIKIQSVLVDDGDAVRLAIEKQ
EKVLRELKMKKPQLNELVHTAEVLKGDVKRQQLQEKELKQFSLAPHCSADLDYMRCCLKV
TRLREHWDETSQCVLQRAAQLKNMLSDSQRFEAKRLELEKWLARMEQRAERMGTIATTAD
ILEAQQKEQKSFHAELHQNKQHFDIFNELTQKLIAVYPNDDTTRIKKMTEVINQRYANLN
SGVINRGKQLHAAVHSLQSFDRAMDQFLAFLSETETLCENAESDIERNPLMFKDLQSEIE
THRVVYDRLDGTGRKLLGSLTSQEDAVMLQRRLDEMNQRWNNLKSKSIAIRNRLESNSEH
WNALLLSLRELTEWVIRKDTELSTLGLGPVRGDAVSLQKQLDDHKAFRRQLEDKRPIVES
NLTSGRQYIANEAAVSDTSDTEANHDSDSRYMSAEEQSRELTRSIRREVGKLSEQWNNLI
DRSDNWKHRLDEYMTKMRQFQKILEDLSSRVALAEQTKTSWLPPSSVGEANEQMQQLQRL
RDKMTTASALLDDCNEQQSFFTANQVLVPTPCLSKLEDLNTRMKLLQIAMDERQKVLCQA
GAQQTHENGDDGRTTSNSGTIGPLPNLGQSVKPPWERATTAANVPYYIDHERETTHWDHP
EMIELMKGLADLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLRAQNDKLI
DIPDMTTVLHSLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGH
LEEKYRYLFRLVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQA
GISQEAIDGNQDISIELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPI
VGFRYRCLKCFNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFK
SRKYFKKHPRVGYLPVQSVLEGDALESPAPSPQHTTHQLQNDMHSRLEMYASRLAQVEYG
GTGSNSTPDSDDEHQLIAQYCQALPGTSNGSAPKSPVQVMAAMDAEQREELEAIIRDLEE
ENANLQAEYQQLCSKEQSGMPEDSNGMQHSSSSMTGLSGQGEQGQDMMAEAKLLRQHKGR
LEARMQILEDHNRQLEAQLQRLRQLLDEPNGGGSSATSSGLPSAPGSALNSKPNTLQTRS
VTASQLNTDSPAKMNQQNGHYEHNSKNSSGLVTVITEQELESINDDLEDSSSSNTTNTTT
TTTTTATTEKTCVELQK
Download sequence
Identical sequences FBpp0083178 FBpp0083178 NP_001036723.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]