SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083179 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083179
Domain Number 1 Region: 7-227
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.45e-62
Family Calponin-homology domain, CH-domain 0.0000455
Further Details:      
 
Domain Number 2 Region: 2509-2629
Classification Level Classification E-value
Superfamily EF-hand 2.85e-39
Family EF-hand modules in multidomain proteins 0.0000597
Further Details:      
 
Domain Number 3 Region: 2630-2734
Classification Level Classification E-value
Superfamily EF-hand 2.99e-32
Family EF-hand modules in multidomain proteins 0.0000769
Further Details:      
 
Domain Number 4 Region: 2717-2803
Classification Level Classification E-value
Superfamily RING/U-box 3.77e-23
Family ZZ domain 0.0066
Further Details:      
 
Domain Number 5 Region: 2156-2285
Classification Level Classification E-value
Superfamily Spectrin repeat 1.03e-18
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 6 Region: 1963-2090
Classification Level Classification E-value
Superfamily Spectrin repeat 8.41e-18
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 2312-2447
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000208
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 8 Region: 428-525
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000144
Family Spectrin repeat 0.0036
Further Details:      
 
Domain Number 9 Region: 2476-2508
Classification Level Classification E-value
Superfamily WW domain 0.00000000549
Family WW domain 0.0014
Further Details:      
 
Domain Number 10 Region: 1227-1366
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000009
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 11 Region: 1894-1995
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000176
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 12 Region: 1352-1482
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000288
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 13 Region: 312-417
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000523
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 14 Region: 1140-1240
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000101
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 15 Region: 491-617
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000561
Family Spectrin repeat 0.016
Further Details:      
 
Weak hits

Sequence:  FBpp0083179
Domain Number - Region: 1009-1125
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00376
Family Spectrin repeat 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083179   Gene: FBgn0260003   Transcript: FBtr0083765
Sequence length 3127
Comment pep:known chromosome:BDGP5:3R:15289255:15421117:1 gene:FBgn0260003 transcript:FBtr0083765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPGILIDERQHIQKKTFTKWINSHLIDTQCTPVKDLFLDLRDGHRLLALLSTLTQTNLK
PEKGRMRVHHINNLNKVITEIQQHGVKLVNISSDDIVGGNAKLTLGLIWLIALEFNGQHL
VKSHSSNGVEKSLLAWARQYTEPHGLQLNDFSSSWSDGRAFLMILDAHVEELNLQAALQQ
HALKRLHLAFDLAHRHFKIEKLLDAEDVHTHKPDNKSIQMYVMCLYHAMESMRTRQQEQE
QDEGQDQDPGRVPCTSITDLDEVPLDNDQTSLGLYTSDSAGSMEQRSSGELKTHSMRPLS
TATNASVEISGYQSALEAVLTLLLEDEQLLSQNLPDPQDFQTAKLQFHENESFMLKLTEH
QEYVGEALEEGSNLINESQKAGAGLSQEDQNEVRQQMVLLNERWETLRLRALDVQAKILM
RLAEFQKQKLEQLRQFLTSVEDRISHMSDIGPTLEEAEKQLLEAQKLKADLSEQQELVDS
LSSMVVIVNDTSGNFNDLEDRLSALGERWSHVVKWSDLRKEKLQQYKCISRWLDAREQDL
KLMESRDVTDVGGITQRINELNYCAKDLLELQRYLIDLRQMVAATLQDGDDKGERVLIQL
ESYEDRLDALKQIVEVQTVRIETKGFNFGRDRASYDDSRVVRPEGWVDYQMIIRFGEDDS
QEDDDEHDLASKKRKLRNADNFNALENHIMEHFGYVQEVEQKLQQLQRQSLRQQCELLKE
LQAENSRRCGTLPELKKLYEVCELEDPSRNLLLEETHIKQLEQRYANLSQKLSSQQSESH
TLLAKEKYYNSLTGFKLVLADSRDWYKQHAGSASGNELEQRLSHMESLASEISEAKTATE
ELDDNLIEWKQDFGLFYDSWHDMKQALQALIQQRGGESLSRQLKQIQDFVTKVSNQKVRV
SNLEVMQEQQHFLNQLLDEMESLRLTYDNIPKHLIGEELQTAWNRLPEQLNERVIKQTTA
IENLNHFAAEYNAIIAMLRSAADSKLNGSDGASSQDLRKLEIDVISARNFSEILIKEAEP
AQKESLQSQIRALNTLYDQVEQVHREKKEQQTVLQSHIDLIQLRLKETDQWLTDLESNTP
KSGISDIVNSNELFQSKSRFQTLKETCERETTQFRDLNERGGELLLQMDELQDQDRESRY
GSLAKQFTRINARWTEVTELVYAKTALLEHISTQLGEFKKFMVSETGYLDKLENKIRNTP
ENAADAEEIMEELDDLENVLRSHSEEWLDKIQEIGNELIDNEFMADSIRRDIDETVQRWT
QLQQQAKKRTELLEQKVSEAEQSEKCIVQFEKWLTRVDDILSDHLDNDVTIVDQPEEFQR
LAHEFVANEKNFKEISELIDEHTRNGKVGAANRLQEQLNLMEVRFKYCQAKLSKCTAIQH
SYESRLNRAYTDLRNVERSTEVVDVASAGPNTVQTQYQKCLQIYRTLSEIKSEIESTIKT
GRRVCEDRYTKSPKQLSQRIDALKHLYNTLGENVTQSKATLERLLTLARQLEECFDSADN
LIRRFESPQEVHDRNSILLEFEDVLRRCEDHYNEYNKSCDQSCMVETRQRIDGLKATYHK
LTSADIIKRLTEMKTTLQNLDNISLETLRAMEHDLKEINVPSNPEIEKLQQQVIAIVVSR
IMTPSTKNPNPFLSKVLESLSSPVDDSNVTLKSPISEEQPQNLDDRVREFDKQAKQMIYK
LKLTKAKIEQCHESEAEDLRLLIAPDAATLISQGDSLVLETHGRQGSISRLVMRTQIILR
EQFREVQQARSKTSGSGAPAPPLDSVNIEELVTKGLRRINVLIEKTVDLKSSTDLEKRME
DINERHDDLQVIVSAIGKNAQMPKVTPLMMNEIEKTKNNLIAHADSIELSLTELRNGPRI
SNGKERPDASSAATMSCRSEYNNEPSGTGALAGSFDKSVLQISDWLTWEQNMIKIQSVLV
DDGDAVRLAIEKQEKVLRELKMKKPQLNELVHTAEVLKGDVKRQQLQEKVTRLREHWDET
SQCVLQRAAQLKNMLSDSQRFEAKRLELEKWLARMEQRAERMGTIATTADILEAQQKEQK
SFHAELHQNKQHFDIFNELTQKLIAVYPNDDTTRIKKMTEVINQRYANLNSGVINRGKQL
HAAVHSLQSFDRAMDQFLAFLSETETLCENAESDIERNPLMFKDLQSEIETHRVVYDRLD
GTGRKLLGSLTSQEDAVMLQRRLDEMNQRWNNLKSKSIAIRNRLESNSEHWNALLLSLRE
LTEWVIRKDTELSTLGLGPVRGDAVSLQKQLDDHKAFRRQLEDKRPIVESNLTSGRQYIA
NEAAVSDTSDTEANHDSDSRYMSAEEQSRELTRSIRREVGKLSEQWNNLIDRSDNWKHRL
DEYMTKMRQFQKILEDLSSRVALAEQTKTSWLPPSSVGEANEQMQQLQRLRDKMTTASAL
LDDCNEQQSFFTANQVLVPTPCLSKLEDLNTRMKLLQIAMDERQKVLCQAGAQQTHENGD
DGRTTSNSGTIGPLPNLGQSVKPPWERATTAANVPYYIDHERETTHWDHPEMIELMKGLA
DLNEIRFSAYRTAMKLRSVQKRLALDRISMSTACESFDRHGLRAQNDKLIDIPDMTTVLH
SLYVTIDKIDLTLMLDLAINWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFR
LVADTDRRADQRRLGLLLHDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAGISQEAIDGN
QDISIELQHFLGWLQHEPQSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKC
FNFDMCQKCFFFGRNAKNHKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPR
VGYLPVQSVLEGDALESPAPSPQHTTHQLQNDMHSRLEMYASRLAQVEYGGTGSNSTPDS
DDEHQLIAQYCQALPGTSNGSAPKSPVQVMAAMDAEQREELEAIIRDLEEENANLQAEYQ
QLCSKEQSGMPEDSNGMQHSSSSMTGLSGQGEQGQDMMAEAKLLRQHKGRLEARMQILED
HNRQLEAQLQRLRQLLDEPNGGGSSATSSGLPSAPGSALNSKPNTLQTRSVTASQLNTDS
PAKMNQQNGHYEHNSKNSSGLVTVITEQELESINDDLEDSSSSNTTNTTTTTTTTATTEK
TCVELQK
Download sequence
Identical sequences NP_001036724.1.81976 FBpp0083179 FBpp0083179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]