SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083180 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083180
Domain Number 1 Region: 1051-1171
Classification Level Classification E-value
Superfamily EF-hand 1.43e-39
Family EF-hand modules in multidomain proteins 0.0000597
Further Details:      
 
Domain Number 2 Region: 1172-1276
Classification Level Classification E-value
Superfamily EF-hand 1.41e-32
Family EF-hand modules in multidomain proteins 0.0000769
Further Details:      
 
Domain Number 3 Region: 1259-1345
Classification Level Classification E-value
Superfamily RING/U-box 1.88e-23
Family ZZ domain 0.0066
Further Details:      
 
Domain Number 4 Region: 698-826
Classification Level Classification E-value
Superfamily Spectrin repeat 4.66e-19
Family Spectrin repeat 0.0063
Further Details:      
 
Domain Number 5 Region: 528-645
Classification Level Classification E-value
Superfamily Spectrin repeat 1.2e-16
Family Spectrin repeat 0.0068
Further Details:      
 
Domain Number 6 Region: 854-989
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000877
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number 7 Region: 1018-1050
Classification Level Classification E-value
Superfamily WW domain 0.00000000267
Family WW domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083180   Gene: FBgn0260003   Transcript: FBtr0083766
Sequence length 1669
Comment pep:known chromosome:BDGP5:3R:15329513:15420453:1 gene:FBgn0260003 transcript:FBtr0083766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAKPPPPIPPTLGGDDSGTHGPKLAPEIPRINSELAAQAALRGQQLLRKQGSQEQHATN
TLPAHKTGAPPPLPPTQSRPVPAIPARGASDRAAPPEIPPKRHSLKSMPDGQPMMVPGLP
PTMRQPPPLPRKPASTQSSAQNSAQSSPLAGMKFKDKPPPPPEKHSTLSAEGMAARRCSN
PFEMPPPPPPLVLQSAVAALSEQSSKNGLNPVPSPAPTRASEAKKINQRSIASPTEEFGS
EDALRGIESGLRNMERAMQEQMNLRNMEAAVQNNFDLSFKASLAAGARHLGGGSVNLRTA
NYERNLSLDEGRAGDSRQSLEELKQLRAQAQQQSLLNNSSSSSSNSQVEQSMRSTIEHHM
RSLDRNLPLELQYSRHRFQNNLNAVAAAGGGGGNSSTGNAVANSGTSGSQQPPMPLSSEF
REQIRQQLLGNIPPQVVHNMGQSPGSAAAAALLQHQAQSRAAAAAAAAAAAAAAAQVAAG
SGALSREELRMRRRSSHDETQLTQNSSGGIQVTRLREHWDETSQCVLQRAAQLKNMLSDS
QRFEAKRLELEKWLARMEQRAERMGTIATTADILEAQQKEQKSFHAELHQNKQHFDIFNE
LTQKLIAVYPNDDTTRIKKMTEVINQRYANLNSGVINRGKQLHAAVHSLQSFDRAMDQFL
AFLSETETLCENAESDIERNPLMFKDLQSEIETHRVVYDRLDGTGRKLLGSLTSQEDAVM
LQRRLDEMNQRWNNLKSKSIAIRNRLESNSEHWNALLLSLRELTEWVIRKDTELSTLGLG
PVRGDAVSLQKQLDDHKAFRRQLEDKRPIVESNLTSGRQYIANEAAVSDTSDTEANHDSD
SRYMSAEEQSRELTRSIRREVGKLSEQWNNLIDRSDNWKHRLDEYMTKMRQFQKILEDLS
SRVALAEQTKTSWLPPSSVGEANEQMQQLQRLRDKMTTASALLDDCNEQQSFFTANQVLV
PTPCLSKLEDLNTRMKLLQIAMDERQKVLCQAGAQQTHENGDDGRTTSNSGTIGPLPNLG
QSVKPPWERATTAANVPYYIDHERETTHWDHPEMIELMKGLADLNEIRFSAYRTAMKLRS
VQKRLALDRISMSTACESFDRHGLRAQNDKLIDIPDMTTVLHSLYVTIDKIDLTLMLDLA
INWILNVYDSQRTGQIRVLSFKVGLVLLCKGHLEEKYRYLFRLVADTDRRADQRRLGLLL
HDCIQVPRQLGEVAAFGGSNIEPSVRSCLEQAGISQEAIDGNQDISIELQHFLGWLQHEP
QSLVWLPVLHRLAAAEAAKHQAKCNICKEYPIVGFRYRCLKCFNFDMCQKCFFFGRNAKN
HKLTHPMHEYCTTTTSTEDVRDFTRALKNKFKSRKYFKKHPRVGYLPVQSVLEGDALESP
APSPQHTTHQLQNDMHSRLEMYASRLAQVEYGGTGSNSTPDSDDEHQLIAQYCQALPGTS
NGSAPKSPVQVMAAMDAEQREELEAIIRDLEEENANLQAEYQQLCSKEQSGMPEDSNGMQ
HSSSSMTGLSGQGEQGQDMMAEAKLLRQHKGRLEARMQILEDHNRQLEAQLQRLRQLLDE
PNGGGSSATSSGLPSAPGSALNSKPNTLQTRSVTASQLNTDSPAKMNQQNGHYEHNSKNS
SGLVTVITEQELESINDDLEDSSSSNTTNTTTTTTTTATTEKTCVELQK
Download sequence
Identical sequences Q9VDW3
FBpp0083180 NP_001036721.1.81976 FBpp0083180

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]