SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083230 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083230
Domain Number 1 Region: 248-448
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.3e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00023
Further Details:      
 
Domain Number 2 Region: 10-238
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.65e-36
Family BAR domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083230   Gene: FBgn0038747   Transcript: FBtr0083821
Sequence length 740
Comment pep:known chromosome:BDGP5:3R:15730861:15739452:1 gene:FBgn0038747 transcript:FBtr0083821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRQFAKIKIAAENLSRSSKSDSKDSELEAIERQVDRYRDTIEKIVRKLPALSGGGGSGS
GSSEEQDKRTKKNSHYKIAQALDESAKELPKDMPLQKVLANCGELEKTMAECIIESELET
EAKVVRRLKNILDKEIQEISTLKRNVSRTLQEYTSLKRSHEAAIRLEEPAAKVNHIKSQQ
EECELKLEKERDAWAAQMLELIAKEDEIVSCIRDYVLNQRNYHERALQHVNASLARIQDT
IQGTEKSRFGTSLKEHLTSTNREISYIVELCCCCLLEHGLEEEGLLRVGCASTKLRRMKH
ALEAQHVKTPLPLDYQDPHVIGSILKLYLRELPEPLLTYNLYKDFIRIAERHSEAERKTE
IKAILTKLPKENYANLRYLTRFLSIVQQRSALNKMSSQNLAIVMSPNMLWPRIDKSSNAP
ADYIGQVNSSSAANIIVELLISQWDYFFIGEVEFYLTLQKQKLFVEGKSKSNSSNENLDR
NDSEVMESPRYGTLRRQKANAPSPPTTNGNGIIMTTSQTSHRPHAKELFPQQTPEKQEKP
AKPPLPNLPQFQSPAASQPTQTQLEPLPPPPVTPAKPVPMTRTQFFGLDNLPSPTADRKS
TDSIGSFKLKPDVPQKPLLPKRPTVLGVGVPKADGKSDDEGGTTPTQATIDNGNGSVRFK
TEHFLDKLRQENGETNGTREVSSTTKENNHNHDPPATAADQNQQQAQPQVTTPISPNSFQ
TPKRPTVPAPPPPTNWKSSD
Download sequence
Identical sequences B5RIZ2 Q9VDS5
7227.FBpp0083230 NP_001287417.1.81976 NP_650844.1.81976 FBpp0083230 FBpp0083230 FBpp0083230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]