SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083293 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083293
Domain Number 1 Region: 179-272
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.55e-21
Family Canonical RBD 0.00028
Further Details:      
 
Weak hits

Sequence:  FBpp0083293
Domain Number - Region: 60-89
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.0421
Family Esterase domain of haemagglutinin-esterase-fusion glycoprotein HEF1 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083293   Gene: FBgn0038796   Transcript: FBtr0083885
Sequence length 273
Comment pep:known chromosome:BDGP5:3R:16233987:16234959:1 gene:FBgn0038796 transcript:FBtr0083885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTFVTSWADEVDADYVDGLPPSNEYIKGDFKYVTEYKFNDDGKKVKVVRTFKIEKQIVP
KAVARRRNWVKFGDSRSDKPGPNSQTTMASEEIFMQFIGSKDFDQTHETQLDPGKNIAKC
RICNGEHWSVNCPYKGTSMDSKTVMETKANAAAAAAISDPSKTGKYVPPFMKDGGGISGS
KNWGRGRDRDDSSAVRISNLSESMTETDLEELVKKIGPHTKMYLAREKNSGLCKGFAYVH
FKFRQDAAAAIEVLNGHGYDHLILCVEWSKPQP
Download sequence
Identical sequences F3YDD7 Q9VDM6
FBpp0083293 FBpp0083293 7227.FBpp0083293 NP_650887.1.81976 FBpp0083293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]