SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083302 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083302
Domain Number 1 Region: 62-361
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 4.58e-54
Family gamma-Butyrobetaine hydroxylase 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083302   Gene: FBgn0038795   Transcript: FBtr0083894
Sequence length 364
Comment pep:known chromosome:BDGP5:3R:16232337:16233568:-1 gene:FBgn0038795 transcript:FBtr0083894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLKHPKTSQSIEINEFWLRDHCRCVECLNFETNQRRYDVLDLPADIMPLDVKYDGMNL
QVQWSDAHKSNYDLDFIFDSQLERLIGRRSKSTNLTPWNRSIILQNERHLRFPLPQLVSS
DNEVRSLVESLVRYGIVFIDDVAPTANMTELALRRVFPLMKTFFGEMWTFSDNPDHADTA
YTKLYLGSHTDNTYFCDAAGLQALHCIEHSGSGGENFFVDGLHVVHELKRRYPAAYDVLC
SVQVPGEYIEKGEHHYHTAPIIQVDPLTQEFVQLRLNVYDRAVFNTIPQAEMAEFYDSLR
QLLLIVRDKQQQWALKLCPGSIVLFDNWRVLHGREAYTGSRTMSGSYVQRTDFLSKARVL
GIID
Download sequence
Identical sequences Q9VDM7
FBpp0083302 7227.FBpp0083302 NP_650886.1.81976 FBpp0083302 FBpp0083302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]