SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083373 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083373
Domain Number 1 Region: 14-302
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.23e-74
Family FCH domain 0.0017
Further Details:      
 
Domain Number 2 Region: 437-492
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-20
Family SH3-domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083373   Gene: FBgn0053094   Transcript: FBtr0083966
Sequence length 494
Comment pep:known chromosome:BDGP5:3R:16658507:16665840:1 gene:FBgn0053094 transcript:FBtr0083966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHHSDDQLLQAGSDSFWEPGNYKRTTKRIEDGYKLCNDLQQLIQERADIEKGYAKSLRT
WSKKWGELIEKGPEYGTTEAAWKGVLTESERISDVHMKIKDNLCNDVNSQIKTWQKENYH
HTLMQIKERKDLEDLFKKAQKPWAKLLAKVEKAKADYHSACKTERSATNQERNANADSSL
SPDQVKKMHDRVQKTKDQVQKCREKYEQAIAEITKYNSVYIEDMTSVFEKCQTFEKTRLQ
FFKEILFNVHSCLDLTKVQSLPQIYEEFSHTINNADQQKDLKWWSNNHGINMAMNWPSFV
EYTEEFRDIAKGNKSKEALPAAPITLINQRPVAEDVHEYPQTNSLKKNTSTLSSVSSRAS
VKSEIATTQSSVTTSEAKTSAAVAGAATATAAATAASAASNRNSSVTNGNGKVDANPFDE
EEEWDESDNVLVDNGEPGVPVKALYDYEGAESDELTFKQGDVFEKLEDEDEQGWCKGRMN
GRVGLYPANYVETA
Download sequence
Identical sequences Q9VDI1
FBpp0083373 NP_788697.1.81976 7227.FBpp0083373 FBpp0083373 FBpp0083373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]