SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083429 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083429
Domain Number 1 Region: 39-368
Classification Level Classification E-value
Superfamily L domain-like 2.38e-34
Family Ngr ectodomain-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083429   Gene: FBgn0038866   Transcript: FBtr0084026
Sequence length 428
Comment pep:known chromosome:BDGP5:3R:16989500:16990883:1 gene:FBgn0038866 transcript:FBtr0084026 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRMLNYLNYILIAVIAFATCESQKLEEIAIDSLDCRENTCTNLKYPSASAVAYFSENVTK
HLRKYETLVLHSSDLANLPRKIFLNLPQLVEFHVLECELQQIESVCFDGAKNLKRLNFGG
NALRVLDSNTFELATQLEELNLSDNQLEDLPTTIFRPLKNLQKINLSNNRLITLSQHIFS
QLGSLKSINVDSNQLVELPGELFRDQRKHLSEFSAQSNQLVRIPFNIFREIDHLSLSFNP
QLRRLHLSAKINELEATNCDLESVELDGRVIGVQLEANPKLHELKISQPQDLEHLYLANT
NLYRLDFLSKASKLVDLDVTDIVNLADLPKITSAKGLERLSFTYDNLTSNHMDMLPHLKD
LNYLEISHEKGKEIFIKDLDEDFFVEEAELNCGQLADLLEFVELPKDTTILEDRLVGDPR
GPMRCGMA
Download sequence
Identical sequences Q9VDD4
FBpp0083429 NP_650952.2.81976 FBpp0083429 FBpp0083429 7227.FBpp0083429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]