SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083431 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083431
Domain Number 1 Region: 93-445
Classification Level Classification E-value
Superfamily L domain-like 3.78e-48
Family Leucine rich effector protein YopM 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083431   Gene: FBgn0038865   Transcript: FBtr0084028
Sequence length 554
Comment pep:known chromosome:BDGP5:3R:16984960:16986814:-1 gene:FBgn0038865 transcript:FBtr0084028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYVRNCLPFLCSYLLISLAATATTDEDADADVDSGSSRIVLVSSLEGHCQTEGKVTSCRG
FEFAGEDEKATFDLPTEVRIAEDGTTYEVGDEEHSRTLIFENCTFTNFPLRLFYTLEVSE
LDMRGCGIRFIYWENFSIGADKLVILLLSDNHIEVLPTKTFRGAGNLEFIFLNRNKLGKL
QAGAFDNLLKLQYLDLTENRLEALAADVFAGLKSLRHVGLAGNQLTTIESDLFAHNPDLL
SVAMQNNRLREVGEYAFRSRGRHHQMQYVDLSNNPELVVLLLNINATNLTARNCSLDRVN
LYGSVTNVDLSDNRVRELYFPASEALEHLVLRNNSLVQLASLSRVPRLRHLDVADNPNLG
QLPDGWRTPHLEMLVLRNTGQMELPLEALQGMQNLQKLDISGNNLTEIDPSAFPTLTQLT
HFYIHGNNWNCFSLRNIMDVLIRANGIAYTVDNYDPDFPGEYFHGIACMYRLPEKEGVDS
SSSSEISASVESSPITSSSDPSEVDKLRDELKAVVQHFDSKFDLIFSKLAQLNEQIQAFE
VLNKTVWSQVTLSV
Download sequence
Identical sequences Q9VDD5
7227.FBpp0083431 FBpp0083431 FBpp0083431 FBpp0083431 NP_650951.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]