SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083436 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0083436
Domain Number - Region: 34-181
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0335
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083436   Gene: FBgn0038856   Transcript: FBtr0084034
Sequence length 766
Comment pep:known chromosome:BDGP5:3R:16930768:16933694:-1 gene:FBgn0038856 transcript:FBtr0084034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKVTVQDIEAVDDYWGPTFRSILEGNNTKQIGDQLEQRIRSHDKEIERICNLYYQGFID
SIQELLQVRTQAQQLHNEVHSLDTSLRQISASLIQQGNDLVRARQIESNLASAIEALKSC
LPALECYMKFTQQAKNKQYYQALRTLETLETEHLTRLKTHNYRFATQMQIQIPIIKENIR
RSSASDFREFLENIRKFSPRIGELAITHTKQLQKRDINAIIAEHMQQMNGGEAGGAGAGG
DDDGANVSAQDLIDFSPIYRCLHIYMVLGQREYFEKDYRQQRRDQAKLVLQPPPNMHDNL
EAYKTYICAIVGFFVVEDHVKNTAGDVVTSSYLEDLWSSSLTKFVNEISMSSSSCTDPNI
LLRIKNLIMLSINTFKCYGYTVNILWELLHNMRDHYNEVLLQRWVHVFREILDKEQFLPM
VVQNTEEYECIIERFPFHSEQLENAPFPKKFPFSRMVPEVYHQAKEFMYACMKFAEELTL
SPNEVAAMVRKAANLLLTRSFSGCLSVVFRQPSITLTQLIQIIIDTQYLEKAGPFLDEFV
CHMTNTERSVSQTPSAMFHVARQDAEKQVGLRICSKIDEFFELSAYDWLLVEPPGIASAF
ITDMISYLKSTFDSFAFKLPHIAQAACRRTFEHIAEKIYSIMYDEDVKQISTGALTQINL
DLMQCEFFAASEPVPGLKEGELSKYFLRNRQLLDLLILEEWSTYFHDYGKQENRYHLVQP
QSIIVILEKIREADKKPIFSLVRKNDKKKLLETVLKQLKHIADRQN
Download sequence
Identical sequences Q9VDE6
FBpp0083436 FBpp0083436 NP_650942.1.81976 FBpp0083436 7227.FBpp0083436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]