SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083595 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083595
Domain Number 1 Region: 6-66
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.27e-18
Family SAM (sterile alpha motif) domain 0.016
Further Details:      
 
Domain Number 2 Region: 736-803
Classification Level Classification E-value
Superfamily SAM/Pointed domain 2.36e-16
Family SAM (sterile alpha motif) domain 0.0025
Further Details:      
 
Domain Number 3 Region: 629-714
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000525
Family SH3-domain 0.0025
Further Details:      
 
Weak hits

Sequence:  FBpp0083595
Domain Number - Region: 152-211
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00549
Family beta-sandwich domain of Sec23/24 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083595   Gene: FBgn0051163   Transcript: FBtr0084197
Sequence length 952
Comment pep:known chromosome:BDGP5:3R:17959557:18120654:1 gene:FBgn0051163 transcript:FBtr0084197 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSNIVCEWLRALGLAQYAESFLDNGYDDLEICKQVGDPDLDAIGVENPAHRHKLLKSI
RSLREKGAASVYFMLNDPNSLSGSMEILCETPPNNELELVLREQLETDGVRLTAHPYSTP
PSSCLSDKEEDEIYGFGYGVFAPRVARGGLTQQQQLLQQQTLQTQQSIQQQQQQMQQQQQ
QLPIVPGQQQQGPHQHQTLPPNVAHLNFVQQNCLSPRSAYFYEFPPTAEGRETKKRTTLA
RLLKGLKTVNRRDRNNQQNGAQARAANDRLRHFQMINGGAGGQQHSFEETIHRLKVQEAM
RKKEKFQREHEEILRDIRQGLLQMSRGEGRMDDTYMYDEALRTGGGMGIAGLGMPLGVGG
NGGGGGAAHYAVSALHHQGHWYDEPPYESDPDDFLMAGLNCGPAATIQGGRVRFSNNRES
TGVISLRSAGDISLPQRGPPRRGLIVPQQPPNPPTIIPLTHARSHDRESGDYAGSISDLQ
SVTSRFSTVSIGTNNCTARYRTLSGGIGESPSLSPSPSSDYEDIGVTRGHGCLPPSLLAA
KAKKNGLPHGKANTICQKATVHHSGEMRSSAKEIGAFNENGRNFVATKDTSRDFSNSQDN
TDRGSMSDQAFACSASSVESLPSASGSSTQALVRPGSPHSSISAEDRTSMASCICKAKAL
VDSLPNPYDKEALKFKKGDLIDVLSMNASGIWKGRCHGRVGHFKFINVEVLPEQRMKNSS
SKTLAAGSRLANSGNGSHNGGPCSVEDLLIRIGLKEYTSVFVLNGYEDLELFKELEPADL
DYLGILNQEHRAKLLTAVQLLHDIECSDVDIPGSSSENDEARLNNINMKHGASPFGRRHF
PRDSGCYEGSPLPSSQTPTQAVNSTDESNSLDDVVTKCSSEIMKRVESARRCKDNPFKTT
LPGGGRLGKKSFLGGNGLMADDTLTRGGLSEKSSDSGVSSSSLSSGPLKSST
Download sequence
Identical sequences Q8SZS0
FBpp0083595 FBpp0083595 NP_732703.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]