SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083630 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083630
Domain Number 1 Region: 34-109
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000606
Family RING finger domain, C3HC4 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083630   Gene: FBgn0038950   Transcript: FBtr0084237
Sequence length 299
Comment pep:known chromosome:BDGP5:3R:18190295:18191703:-1 gene:FBgn0038950 transcript:FBtr0084237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLCKCPKRLVTNQFCFEHRVNVCEHCMVQSHPKCIVQSYLQWLRDSDYISNCTLCGTTL
EQGDCVRLVCYHVFHWDCLNARQAALPANTAPRGHQCPACSVEIFPNANLVSPVADALKS
FLSQVNWGRNGLGLALLSEEQSSSLKAIKPKVASQAAVSNMTKVHHIHSGGERERTKPNG
HDAVSPHSVLLMDAFNPPSAGDYASSRRPLLPRQSPIGGTDRDDNKYQRRTPAELFSRWT
RRFYAPSSRPPWRRTWFLVTAGILAFVLFVYLMAWLGRGGSDAVDEGWNNPNPQPNHYE
Download sequence
Identical sequences B4QZZ7 Q9VD26
FBpp0083630 FBpp0216870 FBpp0083630 FBpp0083630 7227.FBpp0083630 NP_732721.1.81976 XP_002104400.1.80810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]