SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083662 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0083662
Domain Number - Region: 158-237
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0837
Family IMD domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083662   Gene: FBgn0038993   Transcript: FBtr0084269
Sequence length 362
Comment pep:known chromosome:BDGP5:3R:18435207:18436437:1 gene:FBgn0038993 transcript:FBtr0084269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIAKLKQEYAERWHYPPIVPPAKLRYVACGKVAFYGHNDKPKYKPCWQHPLNVQDQTRFG
VCWEYPPERYKRRPLPPPCRGSTIPIHLLKPTFKHCENIYSRYDFKLEQCVHEQTLVVDQ
KMKALKNELEQAKPFQIERVKEMRYHGVRYRILASSTGCTKTYPEYISRMTEERALCEFQ
RAYNIVNQSNTDLSNLYLDMSESKKELDQRVARLDRSLGSTFLKELDSVLQIIEDLNTYF
FGVIVKLKTWAELMDPMKEHSIEDYLGLLSQETDFRTFMSAGMENCTCKRCDKKDPLKPY
LPCWCQMESSEDVTNLKNFDDDCPKNIAGITQHESDIVTPSDTSLLVRAADEKARLAMNQ
AE
Download sequence
Identical sequences Q9VCX6
FBpp0083662 FBpp0083662 7227.FBpp0083662 FBpp0083662 NP_651069.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]