SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083681 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083681
Domain Number 1 Region: 18-328
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 6.59e-67
Family Penicillin synthase-like 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083681   Gene: FBgn0053099   Transcript: FBtr0084288
Sequence length 331
Comment pep:known chromosome:BDGP5:3R:18354642:18356277:-1 gene:FBgn0053099 transcript:FBtr0084288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINSKIREDKLETLVSRSSVPIIDLAHCGKSLVHRVGQQLHKAFTEKGIAFLVNHGIAED
KIKAVWDQFDNFLDLPAEVQDRYRRKDGVNYGYVSPGMERFDGSTPELRHAYNVCKLDGQ
NIPREALPEFAEGITTLCTDLKAMSLYIMKAMEVALEIPPSFFIDKHSQMLEGDDLNMTT
LRMLYYPAIVDDEPGQSEGAIRCGAHVDYGTFTLLAQDSEGGLEVQLPGSEKWERVGHLP
GAILINGGELLSIWTKQRYHALPHRVVIPEQELIRTRGRHSIAYFCHPNNSILISPNDLL
SEGEAKSEDKVYSAYELIQKKFNDTYGQRSQ
Download sequence
Identical sequences Q86B83
NP_788714.1.81976 FBpp0083681 7227.FBpp0083681 FBpp0083681 FBpp0083681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]