SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083682 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083682
Domain Number 1 Region: 20-200,252-360
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.95e-58
Family Penicillin synthase-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083682   Gene: FBgn0038981   Transcript: FBtr0084289
Sequence length 403
Comment pep:known chromosome:BDGP5:3R:18345804:18354383:-1 gene:FBgn0038981 transcript:FBtr0084289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKTKSSDDKLDTLLSRSVVPIIDLAHCGIEEVPVKSVVNRVGHQLKKALSEKGMALLVN
HGISDEKLKTAWDHLDDFVNLPPDIRQHYIRADGDKHGYVSRGQQQRFDGKSPELRHAFN
ISTLNAQNLPEEPLPGFADHISTLATDFKALASFILQALAVSLDIPHTFFLEKHSHMLSG
DHDNMSSLRMLYYPPIVDDEPGQNDVIKGRCQYSYQRCLSNQPDFRPEHNPRDEDDLNEV
DGPNGQLFEHKLGNGAVIQCPPHVDYGTFTLLSQDSEGGLEVRLPGSEKWNRVGHLPGSI
LVNCGEILNIWTQGRYPALQHRVIIPEQETIRARGRHSIAFFCHPDNITTISPTDLPNPD
AVQDKACLKQRKKSFKAAKERVYNAYQLIQKKFRDTYSSNNHS
Download sequence
Identical sequences Q9VCZ2
7227.FBpp0083682 NP_651058.1.81976 FBpp0083682 FBpp0083682 FBpp0083682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]