SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083736 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083736
Domain Number 1 Region: 37-106
Classification Level Classification E-value
Superfamily PDZ domain-like 4.99e-17
Family PDZ domain 0.059
Further Details:      
 
Domain Number 2 Region: 141-185
Classification Level Classification E-value
Superfamily RING/U-box 0.0000574
Family RING finger domain, C3HC4 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083736   Gene: FBgn0039038   Transcript: FBtr0084343
Sequence length 424
Comment pep:known chromosome:BDGP5:3R:18838134:18841197:1 gene:FBgn0039038 transcript:FBtr0084343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKSAGGFHSTSNEDGQHGDGSSVRLLRIPRAAPAMENYGFQLTRSKWDPYPWVCEVAAG
TPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDCVTILCWNSECDKDCDTNSIC
CAPMPTSLRRLSLVLESILRLVECPVCGVTISPPAMQCQNGHLLCVDCRIRSERCPVCRD
FYTPRRALLAEQIFLTIANAFEMCRSENKLRQKLFAGITRPVVGRQDRITGQDTWRKRRP
VLPTNKFLTKLLEGCAYSTDNLSPSNAATLLRTNTTDVAGDSSEIPARTSPVTATPPERT
TMHATLDANAAHPSLSTNDLQQEGVKPNAEGVDEESGTNSSHISATSLHGPPLPASVSPG
INESSGLQPVRIPPVTPSQDLPQQVVQTKPASLLYRCPCKLQDPQDPAKDLHQNCCYKSA
FRLL
Download sequence
Identical sequences Q9VCS4
7227.FBpp0083736 FBpp0083736 FBpp0083736 FBpp0083736 NP_651110.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]