SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083793 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083793
Domain Number 1 Region: 9-347
Classification Level Classification E-value
Superfamily V-type ATP synthase subunit C 3.14e-67
Family V-type ATP synthase subunit C 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083793   Gene: FBgn0039058   Transcript: FBtr0084401
Sequence length 350
Comment pep:known chromosome:BDGP5:3R:18983739:18985038:-1 gene:FBgn0039058 transcript:FBtr0084401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMIFNTEYGYLEALTRGFKNGMLKHSDYLNLTQCESLEDVMISIQGTDYGLIFGGEQSA
PSVEVIERCLRDRLLQQYYYIRSHSTEPLTTFMEFIRYPFMIDNVALLVAGLNNHRSMKR
LLRMCHPLGEFDQLGAIEVASNSAELFDAVLIDTPIARFVPRDLPMESLRYLDVEIVRAH
LYRAYLEKFYAYCSQLGGNTANVMTNLLSFEADRRTITIAVNAIGSDIIPKERLKMFPTC
GYLPKIALASMSTLNDTDKIRDVCNVFDGYGKMFDNLERDSDGMITLEDRFLMMEAKKNV
QTFLQQYHFGIFYSFIKLKQLEVRNIVWISECIAQRQTDRINAFIPIPLD
Download sequence
Identical sequences Q9VCQ3
FBpp0083793 FBpp0083793 FBpp0083793 7227.FBpp0083793 NP_651128.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]