SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083886 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083886
Domain Number 1 Region: 609-760,818-998
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.36e-52
Family Diacylglycerol kinase-like 0.017
Further Details:      
 
Domain Number 2 Region: 414-515
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.14e-18
Family Ras-binding domain, RBD 0.0073
Further Details:      
 
Domain Number 3 Region: 4-56
Classification Level Classification E-value
Superfamily Cysteine-rich domain 9.42e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.003
Further Details:      
 
Domain Number 4 Region: 116-190
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.03e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0025
Further Details:      
 
Domain Number 5 Region: 66-119
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000262
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.043
Further Details:      
 
Domain Number 6 Region: 323-383
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000103
Family Ras-binding domain, RBD 0.038
Further Details:      
 
Domain Number 7 Region: 517-595
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000111
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083886   Gene: FBgn0051140   Transcript: FBtr0084498
Sequence length 1055
Comment pep:known chromosome:BDGP5:3R:19788902:19808954:1 gene:FBgn0051140 transcript:FBtr0084498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGGHSFVKKTFHKPTYCHHCSDLLWGLIQQGYICEVCNFIIHERCVSSVVTPCSGIAP
CIIKNPVAHCWSEPTHHKRKFCTVCRKRLDETPAVHCLVCEYFAHIECQDFAVPDCTENA
TYVPGKELLNVKHQHHWREGNLPSTSKCAYCKKTCWSSECLTGYRCEWCGMTTHAGCRMY
LPTECNFGILQPIYLPPHSVSIPRTEVPIEAIIGVQVKSKTSLVRDYSCPRSISEEFSSG
DTPRFKDEESASKAESGHGPSSGGAGGGGGSGGAGGSSAAGASASAAGGSSGHYRPDSGS
GHKSDKSEKDREKKEKEREEKDIEMIKVFDGNNSFRRQQYRVIIVQRTYTLEQLLTTALR
AFHITRDPQAFYLTDLYAPAGMEDTPMLDPTPVLNLVHLEGKRPAIYLRFHDRDRGHVRV
YPGKLQCSMLEDPYVSVPVDNSTVIKDLIRDALDKFGLQDNQIQDYRCSEVLLDRGVTER
ILSWNERPWDIMKQLGKDSIRQMELMRFYMQHKQDPHGPNIALFVGNLPTGLSQRNYEQI
LNKYVTDENKFISIGPIYYEYGSVVLTFEDSMKAVRAFYNLRETIIEDKKLLVLLLPNIE
PSMVPSDVRPLLVFVNVKSGGCQGLELISSFRKLLNPYQVFDLDNGGPLPGYVQPITVFV
IRPLIFDSIISLYVFRQITNYKILVCGGDGTIGWVLQCLDNVGQDSECSSPPCAIVPLGT
GNDLARVLCWGSGYTGGEDPLNLLRDVIEAEEIRLDRWTVVFHPEDKPEEPAMKAPSQTT
GKKKKAHQAHLSQSQQTNQHHQLPALTSSDISGGAQNEDNSQIFVMNNYFGIGIDADLCL
DFHNAREENPNQFNSRLRNKGYYVKMGLRKIVGRKAVKDLQKELRLEVDGKIVELPPVDG
IIILNILSWGSGANPWGPDKDDQFSTPNHYDGMLEVVGVTGVVHLGQIQSGIRTAMRIAQ
GGHIKIHLNTDMPVQVDGEPWIQSPGDVVVLKSALKATMLKKNKLKMKRRNTEPTMMVAG
SAAPPLSLALPPSVGEVGVAGEGAEGDGGTNNTDF
Download sequence
Identical sequences Q7KS35
FBpp0083886 NP_996276.1.81976 FBpp0083886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]