SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083911 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083911
Domain Number 1 Region: 22-144
Classification Level Classification E-value
Superfamily Bromodomain 1.83e-34
Family Bromodomain 0.00035
Further Details:      
 
Domain Number 2 Region: 283-428
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000000275
Family Bromodomain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083911   Gene: FBgn0039124   Transcript: FBtr0084525
Sequence length 513
Comment pep:known chromosome:BDGP5:3R:19717406:19719105:-1 gene:FBgn0039124 transcript:FBtr0084525 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNELQSNSNQPPPRNEPYLQPVNGIVQPPVIPPPNRPGRRTNILEELKSVLNCLWRNRFS
YHFRHPVDSVSLGVPDYHAVVKHPMDLSTIRKRLHNKYYWQASEALEDFKLIFDNCLLYN
LEGSPVYQAGKLLMEAFYMRMESIDLSTEVELKPKSEKRKRKATESLDQASTSFSAPRAS
NNYSRQWLSSSSSWLCPPPMPGGVSSFNPSFRNFVGPSLIPSFMPDSLVNPMQSMHPMSS
MMNPIFKNNWETNEAMDPPPSEPISYRPLDSLAAPLPSPPMEPMTLPWPTPAPVESPASS
PPPAPNPPIIICYKSLDRMIEKSHSDHLLKSMVKRKRKQVTWAFNQADYWRRYSQNPDYD
HDREEKLDWKILQERLDSDNFESFDGFVSSVRKMFQNALRCFPEDGLVKVSVKKTNEIFE
KRLPKYRELIATAKEKGRQLVASREQDFRDSQNLLIKQENANKNFKGWVPKPFIIKTESL
FVQEQRVYKMEPQDVQEFSPGTEPLDDQTYDSD
Download sequence
Identical sequences Q9VCG6
7227.FBpp0083911 FBpp0083911 FBpp0083911 NP_651190.1.81976 FBpp0083911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]