SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0083952 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0083952
Domain Number 1 Region: 185-528
Classification Level Classification E-value
Superfamily DNase I-like 4.97e-38
Family DNase I-like 0.078
Further Details:      
 
Domain Number 2 Region: 42-157
Classification Level Classification E-value
Superfamily L domain-like 1.26e-19
Family Ngr ectodomain-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0083952   Gene: FBgn0011725   Transcript: FBtr0084567
Sequence length 545
Comment pep:known chromosome:BDGP5:3R:20023510:20047157:-1 gene:FBgn0011725 transcript:FBtr0084567 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRNKDKYDSANRRQQIFLSQEDIAAGKKTNWSGLEITGCVRNISPSLWEFEHLTALYLN
DNQLLRLPADVGMLTSLRTLDLSSNKLRSLPAELGELIQLRELLLNNNFLRVLPYEIGKL
FHLVILGLMGNPLQKEFMNIYNEPNGTQKLLTYMLDNLSFTVNPPPQRPWLPLAKPNKTR
PACIFTVMCYNVLCDKYATRQMYGYCPSWALCWEYRKKSIIDEIRHYAADIISLQEIETE
QFYHFFLPELKNDGYEGIFSPKSRAKTMSELERKYVDGCAIFFRASKFTLIKESLIEFNQ
LAMANAEGSDNMLNRVMPKDNIGLAALLKVKENAWEPMSEVTQISQPLLVCTAHIHWDPE
FCDVKLIQTMMLSNELKTIIDEASHSFRPGHKNDSNAVQLLLCGDFNSLPDSGVVEFLGK
GRVSMDHLDFKDMGYKSCLQRLLSNDTNEFTHSFKLASAYNEDIMPHTNYTFDFKGIIDY
IFYTKTGMVPLGLLGPVSNDWLRENKVVGCPHPHIPSDHFPLLVELELMHTASQQAPPNG
LINRR
Download sequence
Identical sequences Q9VCB6
FBpp0083952 NP_732967.1.81976 XP_016036007.1.80810 FBpp0083952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]