SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084076 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084076
Domain Number 1 Region: 128-237
Classification Level Classification E-value
Superfamily TPR-like 6.03e-20
Family Tetratricopeptide repeat (TPR) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084076   Gene: FBgn0039228   Transcript: FBtr0084698
Sequence length 250
Comment pep:known chromosome:BDGP5:3R:20633343:20634399:1 gene:FBgn0039228 transcript:FBtr0084698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANEEVKDNAQLKATMLNCNLNPSVADDFAEFEATLAKIDCILQNKAPCDDEDSKAGGDA
KEKINFDNLDVDKVRLKVKENRTVINRKSLEEDNEKQVKDMNQKSFMEQVEKDANDRAEA
RAKAEYEAELQRSQGNEAFRSQKYEKAILHYDKAIIKVKDSAITYCNRALCYIKLQNYKR
ALKDCQYVLEKLQESNLRAWLYQAHAYKGLKQDDKFEESVVKAREHNPKQLAYIDKYIKQ
LEADLKALEI
Download sequence
Identical sequences Q9VC34
FBpp0084076 FBpp0084076 FBpp0084076 7227.FBpp0084076 NP_651289.1.81976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]