SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084078 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084078
Domain Number 1 Region: 311-405
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.66e-21
Family Canonical RBD 0.0018
Further Details:      
 
Domain Number 2 Region: 8-43
Classification Level Classification E-value
Superfamily SAP domain 0.00000115
Family SAP domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084078   Gene: FBgn0039229   Transcript: FBtr0084700
Sequence length 928
Comment pep:known chromosome:BDGP5:3R:20643186:20648072:1 gene:FBgn0039229 transcript:FBtr0084700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEAGKKIAELRVCDLKSELEKRELETVGPKAVLIERLEKSLRAEGLDPATHLIVPGAKA
KKPFAMPMKDLQSEVVIKEEPIDANEEEVKVEQQDDYQNGNDYSHHADDDGHEIDQVGDV
DDECVILDDDDEEDEDHVYDDEPQSGDGDAEGKAQDDGAENNGDDKAIIHGEEENTGDTG
NMDNDESINLTIGEDEQKLLHDEASDDKSIKSVKPANKSEKSNSKDADKKNDDGARSKKR
DEKSGDKKDSSEQKSSGKSSNQKDDKEKSTAAPGGATSSTASSAAGSKSGSGSSAGNGTG
ANSNNKQATLSRNLWVSGLSTLTRASDLKAIFSKFGKVIGAKVVTNTRTPGTRCYGYVTM
SSSADASRCIENLHRTELHGRIISVERTKNEIGGSLNSKEGKGKAPGDAGNKKKEDDSGK
KSGSGKGSSSNSGDDKKGGDGNGDSKSVGGDLKRDGKESNRARSRRNDDRGKSLASQDRP
RHDRERSAKGSQDHRSGRNPRDVDREIQQRQRERERRQREMLSYQKIREERERQRLRERE
RELREEERRRREARERQRIEEERLQEERRKLAVERERLEREKAELLRMERERQKLEREKI
ELERLELKRQQMKIMESRDDPGKRGVSKRADDRYGDVTDRKRTAIFDAPPPPRFDTNLVS
SRSTYDKKHDDYGSSSSTKRVLDDYSSSSKRLDYSSKRNDYSSSSGSKRGAVDDYTAVPT
KRSNDYSASSSSKRDDYKRDEVRHLPLSGTVGGGSSSSYLHKNNTAGGGAGSYVHKNNTS
GTGGRYNDSDRSNTSSYRRDDSHSLGNKRYDNSSGGGGAYGSSSNSVNIWAPSSGGSSSH
LGSGGGGGNQIKSYGNNGMSSNMHSTNSWQKSAPVDDNGWRQVPARFDRGYNERSTGYQG
QSGGGGAGGMYGASRPAQDRYSGPVSRY
Download sequence
Identical sequences Q8IMV6
NP_733041.2.81976 FBpp0084078 7227.FBpp0084078 FBpp0084078 FBpp0084078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]