SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for FBpp0084110 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084110
Domain Number 1 Region: 331-390
Classification Level Classification E-value
Superfamily RING/U-box 0.0000971
Family U-box 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084110   Gene: FBgn0051357   Transcript: FBtr0084735
Sequence length 394
Comment pep:known chromosome:BDGP5:3R:20654001:20655645:-1 gene:FBgn0051357 transcript:FBtr0084735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEIKALEHATLKVPYEMLNKRFRSAQKIIDREVDQVINVSRQVEKALEAEEGPILAEVT
KLVDNVAQKLQVLKRKAEESINDELSVTQICKRKLDHLKGITPPSSVTGDLWQGSVDQWK
RIRLDRLVIEHLLRMGYYETAEELAAKSDVRHLTNLDIFQTSREVEDDLASHSTTKCVLW
CIDNKSKLRKINSTIEFSLRVQEFIELVRQNQRFEAVKHSRRYFPAYEKTQLNEICHVMA
LLAYPADAQAEHYRKYMDPQRWQKLVLDFRQENYRLFQLSSTSVFSAAVQAGLSALKTPH
CYAQTCRNLNCPVCQEDLNRIALKLPYSHCVQSRLICRVTGLPLNEHNQPMMLPNGQIFG
QMALPDITKDDGTVTCPVTNTKFSNPKVEKVFVM
Download sequence
Identical sequences Q8MSB1
7227.FBpp0084110 FBpp0084110 NP_733044.1.81976 FBpp0084110 FBpp0084110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]